LMPD Database

LMP012343

Record overview

LMPD ID	LMP012343
Gene ID	3952
Species	Homo sapiens (Human)
Gene Name	leptin
Gene Symbol	LEP
Synonyms	OB; OBS; LEPD;
Chromosome	7
Map Location	7q31.3
Summary	This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for LEP

Proteins

leptin precursor

Refseq ID:	NP_000221
Protein GI:	4557715
UniProt ID:	P41159
mRNA ID:	NM_000230
Length:	167
RefSeq Status:

`MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISND LENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC`

sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2632
peptide sequence: 
MHWGTLCGFLWLWPYLFYVQA
mat_peptide: 22..167
product: leptin
calculated_mol_wt: 16027
peptide sequence: 
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPW
ASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC