LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP001324

Record overview

LMPD IDLMP001324
Gene ID18780
SpeciesMus musculus(Mouse)
Gene Namephospholipase A2, group IIA (platelets, synovial fluid)
Gene SymbolPla2g2a
SynonymsEF; Mom1; Pla2; sPLA2; sPla2-IIA
Alternate namesphospholipase A2, membrane associated; GIIC sPLA2; enhancing factor; modifier of Min1; group IIA phospholipase A2; phospholipase A2 group IIa; secretory group II phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; non-pancreatic secreted type II phospholipase A2
Chromosome4
Map Location4 D3|4 70.57 cM
EC Number3.1.1.4
SummaryProteins belonging to the phospholipase A2 (PLA2) family hydrolyze phospholipids into sn2 fatty acids and lysophospholipids. They function in a variety of cellular processes, including the digestion of phospholipids and the production of molecules that induce inflammatory responses. This gene encodes a member of the group II class of secretory PLA2s. The secreted enzyme binds to heparin on the cell surface. Mutations in this gene increase the occurrence of intestinal polyps caused by a dominant mutation in the adenomatosis polyposis coli gene. A frameshift inactivates this gene product in some mouse strains including the strain of the reference genome, C57BL/6J, whereas a functional protein is produced in other strains. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for Pla2g2a

Proteins

phospholipase A2, membrane associated precursor
Refseq ID:NP_001076000
Protein GI:132626633
UniProt ID:P31482
mRNA ID:NM_001082531
Length:146
RefSeq Status:REVIEWED
MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSA
NQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC
 
sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2191
peptide sequence: 
MKVLLLLAASIMAFGSIQVQG

mat_peptide: 22..146
product: phospholipase A2, membrane associated
calculated_mol_wt: 13972
peptide sequence: 
NIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFA
RNKKTYSLKYQFYPNMFCKGKKPKC