Gene/Proteome Database (LMPD)
Proteins
| palmitoyltransferase ZDHHC15 | |
|---|---|
| Refseq ID | NP_001181016 |
| Protein GI | 302564117 |
| UniProt ID | F7GXS3 |
| mRNA ID | NM_001194087 |
| Length | 337 |
| Protein sequence is identical to GI:109131277 (mRNA isoform) | |
| Refseq ID | XP_001097861 |
| Protein GI | 109131277 |
| UniProt ID | F7GXS3 |
| mRNA ID | XM_001097861 |
| Length | 337 |
| MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIFYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCNLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEEPWEDNEDDNQDYPEGSSSLAVETET | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0045184 | IEA:Ensembl | P | establishment of protein localization |
| GO:0018345 | IEA:Ensembl | P | protein palmitoylation |
| GO:0016188 | IEA:Ensembl | P | synaptic vesicle maturation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 15
Protein Entry
F7GXS3_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP015024 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109131277 | RefSeq | XP_001097861 | 337 | zinc finger, DHHC-type containing 15 |
Identical Sequences to LMP015024 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302564117 | GenBank | AFE65489.1 | 337 | palmitoyltransferase ZDHHC15 isoform 1 [Macaca mulatta] |
| GI:302564117 | RefSeq | XP_003917951.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Papio anubis] |
| GI:302564117 | RefSeq | XP_005594041.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Macaca fascicularis] |
| GI:302564117 | RefSeq | XP_007990304.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Chlorocebus sabaeus] |
Related Sequences to LMP015024 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302564117 | GenBank | EHH30859.1 | 337 | Palmitoyltransferase ZDHHC15 [Macaca mulatta] |