Gene/Proteome Database (LMPD)

LMPD ID
LMP014929
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
StAR-related lipid transfer (START) domain containing 3
Gene Symbol
Alternate Names
StAR-related lipid transfer (START) domain containing 3;
Chromosome
16
Map Location
chromosome:16

Proteins

Refseq ID XP_002800489
Protein GI 297272842
UniProt ID F7B936
mRNA ID XM_001089498
Length 427
MSKLPGELARDLECSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLQHWWVIALLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQAAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGMVSPRDFVNVRRIERRRDRYLSSGIATAHSAKPLTHKYVRGENGPGGFVVLKSASNPCVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA
Refseq ID XP_001089498
Protein GI 109114884
UniProt ID F7HE48
mRNA ID XM_001089498
Length 445
MSKLPGELARDLECSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLQHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQAAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGMVSPRDFVNVRRIERRRDRYLSSGIATAHSAKPLTHKYVRGENGPGGFVVLKSASNPCVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA

Gene Information

Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005768 IEA:Ensembl C endosome
GO:0005765 IEA:Ensembl C lysosomal membrane
GO:0005739 IEA:Ensembl C mitochondrion
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0006701 IEA:Ensembl P progesterone biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR019498 MENTAL domain
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom
IPR000799 Steroidogenic acute regulatory protein-like

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 3
Protein Entry
F7HE48_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Contains START domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014929 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109114884 RefSeq XP_001089498 445 StAR-related lipid transfer (START) domain containing 3
297272842 RefSeq XP_002800489 427 StAR-related lipid transfer (START) domain containing 3

Identical Sequences to LMP014929 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014929 proteins

Reference Database Accession Length Protein Name
GI:297272842 GenBank EHH24897.1 445 START domain-containing protein 3 [Macaca mulatta]
GI:297272842 GenBank AFE76406.1 445 stAR-related lipid transfer protein 3 isoform 1 [Macaca mulatta]
GI:297272842 GenBank AFH30898.1 445 stAR-related lipid transfer protein 3 isoform 1 [Macaca mulatta]
GI:297272842 GenBank AFI36087.1 445 stAR-related lipid transfer protein 3 isoform 1 [Macaca mulatta]