Gene/Proteome Database (LMPD)
LMPD ID
LMP014847
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Gene Symbol
Alternate Names
solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; mitochondrial carnitine/acylcarnitine carrier protein;
Chromosome
2
Map Location
chromosome:2
Proteins
| solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 | |
|---|---|
| Refseq ID | NP_001252793 |
| Protein GI | 388453787 |
| UniProt ID | F6Q4M5 |
| mRNA ID | NM_001265864 |
| Length | 301 |
| Protein sequence is identical to GI:109039803 (mRNA isoform) | |
| Refseq ID | XP_001111751 |
| Protein GI | 109039803 |
| UniProt ID | F6Q4M5 |
| mRNA ID | XM_001111751 |
| Length | 301 |
| MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGIRGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGETKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSVPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL | |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | IEA:Ensembl | C | mitochondrial inner membrane |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Protein Entry
F6Q4M5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014847 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109039803 | RefSeq | XP_001111751 | 301 | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
Identical Sequences to LMP014847 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388453787 | GenBank | EHH51327.1 | 301 | hypothetical protein EGM_10682 [Macaca fascicularis] |
| GI:388453787 | GenBank | AFE65362.1 | 301 | mitochondrial carnitine/acylcarnitine carrier protein [Macaca mulatta] |
| GI:388453787 | GenBank | AFH30173.1 | 301 | mitochondrial carnitine/acylcarnitine carrier protein [Macaca mulatta] |
| GI:388453787 | RefSeq | XP_003894511.1 | 301 | PREDICTED: mitochondrial carnitine/acylcarnitine carrier protein [Papio anubis] |
Related Sequences to LMP014847 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388453787 | GenBank | EHH16383.1 | 301 | hypothetical protein EGK_11657 [Macaca mulatta] |