Gene/Proteome Database (LMPD)

LMPD ID
LMP014753
Gene ID
704993
Species
Macaca mulatta (Rhesus monkey)
Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Gene Symbol
RARRES2
Alternate Names
retinoic acid receptor responder protein 2;
Chromosome
3
Map Location
chromosome:3

Proteins

retinoic acid receptor responder protein 2 precursor
Refseq ID NP_001253612
Protein GI 388454368
UniProt ID H9H322
mRNA ID NM_001266683
Length 163
Protein sequence is identical to GI:109069378 (mRNA isoform)
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2106 peptide sequence: MRRLLIPLALWLGAVGVGVA
Refseq ID XP_001088949
Protein GI 109069378
UniProt ID H9H322
mRNA ID XM_001088949
Length 163
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETGVDSAVDTHFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEGKVLGRMVHCPIETQVLREPEEHQETQCIRVQRAGEDPHSFYFPGQFAFSKALPHS
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2106 peptide sequence: MRRLLIPLALWLGAVGVGVA

Gene Information

Entrez Gene ID
704993
Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Gene Symbol
RARRES2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031012 IEA:Ensembl C extracellular matrix
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0050873 IEA:Ensembl P brown fat cell differentiation
GO:0048566 IEA:Ensembl P embryonic digestive tract development
GO:0001701 IEA:Ensembl P in utero embryonic development
GO:0006954 IEA:InterPro P inflammatory response
GO:0045600 IEA:Ensembl P positive regulation of fat cell differentiation
GO:2001275 IEA:Ensembl P positive regulation of glucose import in response to insulin stimulus
GO:0010759 IEA:Ensembl P positive regulation of macrophage chemotaxis
GO:0001934 IEA:Ensembl P positive regulation of protein phosphorylation
GO:0050994 IEA:Ensembl P regulation of lipid catabolic process
GO:0001523 IEA:Ensembl P retinoid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR029562 Retinoic acid receptor responder protein 2

UniProt Annotations

Entry Information

Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Protein Entry
H9H322_MACMU
UniProt ID
H9H322
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014753 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109069378 RefSeq XP_001088949 163 retinoic acid receptor responder (tazarotene induced) 2

Identical Sequences to LMP014753 proteins

Reference Database Accession Length Protein Name
GI:388454368 RefSeq XP_003896882.1 163 PREDICTED: retinoic acid receptor responder protein 2 [Papio anubis]
GI:388454368 RefSeq XP_005595735.1 163 PREDICTED: retinoic acid receptor responder protein 2-like isoform X1 [Macaca fascicularis]
GI:388454368 RefSeq XP_005595736.1 163 PREDICTED: retinoic acid receptor responder protein 2-like isoform X2 [Macaca fascicularis]
GI:388454368 RefSeq XP_005595737.1 163 PREDICTED: retinoic acid receptor responder protein 2-like isoform X3 [Macaca fascicularis]

Related Sequences to LMP014753 proteins

Reference Database Accession Length Protein Name
GI:388454368 GenBank AFJ71641.1 163 retinoic acid receptor responder protein 2 precursor [Macaca mulatta]