Gene/Proteome Database (LMPD)

LMPD ID
LMP014744
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Gene Symbol
Alternate Names
protein-tyrosine phosphatase mitochondrial 1;
Chromosome
14
Map Location
chromosome:14

Proteins

protein-tyrosine phosphatase mitochondrial 1
Refseq ID NP_001252732
Protein GI 388453263
UniProt ID F6ZLY2
mRNA ID NM_001265803
Length 201
Protein sequence is identical to GI:109106403 (mRNA isoform)
Refseq ID XP_001105550
Protein GI 109106403
UniProt ID F6ZLY2
mRNA ID XM_001105550
Length 201
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCHSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHRWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQVTAGAAKDGTFDTSKT

Gene Information

Entrez Gene ID
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004725 IEA:InterPro F protein tyrosine phosphatase activity
GO:0008138 IEA:InterPro F protein tyrosine/serine/threonine phosphatase activity

Domain Information

InterPro Annotations

Accession Description
IPR024950 Dual specificity phosphatase
IPR000340 Dual specificity phosphatase, catalytic domain
IPR016130 Protein-tyrosine phosphatase, active site
IPR029021 Protein-tyrosine phosphatase-like
IPR000387 Protein-tyrosine/Dual specificity phosphatase

UniProt Annotations

Entry Information

Gene Name
protein tyrosine phosphatase, mitochondrial 1
Protein Entry
F6ZLY2_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014744 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109106403 RefSeq XP_001105550 201 protein tyrosine phosphatase, mitochondrial 1

Identical Sequences to LMP014744 proteins

Reference Database Accession Length Protein Name
GI:388453263 GenBank AFJ72001.1 201 protein-tyrosine phosphatase mitochondrial 1 isoform 1 [Macaca mulatta]
GI:388453263 RefSeq XP_005577987.1 201 PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 [Macaca fascicularis]
GI:388453263 RefSeq XP_007997553.1 201 PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 [Chlorocebus sabaeus]
GI:388453263 RefSeq XP_009184359.1 201 PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform X1 [Papio anubis]

Related Sequences to LMP014744 proteins

Reference Database Accession Length Protein Name