Gene/Proteome Database (LMPD)
Proteins
| prostaglandin E synthase | |
|---|---|
| Refseq ID | NP_001248097 |
| Protein GI | 386781181 |
| UniProt ID | G7NFJ9 |
| mRNA ID | NM_001261168 |
| Length | 152 |
| Protein sequence is identical to GI:109110034 (mRNA isoform) | |
| Refseq ID | XP_001107574 |
| Protein GI | 109110034 |
| UniProt ID | G7NFJ9 |
| mRNA ID | XM_001107574 |
| Length | 152 |
| MPAHSLAMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLLGRVVHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:Ensembl | C | cytoplasm |
| GO:0016021 | IEA:Ensembl | C | integral component of membrane |
| GO:0005641 | IEA:Ensembl | C | nuclear envelope lumen |
| GO:0043295 | IEA:Ensembl | F | glutathione binding |
| GO:0050220 | IEA:Ensembl | F | prostaglandin-E synthase activity |
| GO:0008285 | IEA:Ensembl | P | negative regulation of cell proliferation |
| GO:0001516 | IEA:Ensembl | P | prostaglandin biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin E synthase
Protein Entry
G7NFJ9_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014728 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109110034 | RefSeq | XP_001107574 | 152 | prostaglandin E synthase |
Identical Sequences to LMP014728 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781181 | GenBank | AFH34732.1 | 152 | prostaglandin E synthase [Macaca mulatta] |
| GI:386781181 | RefSeq | XP_003911250.1 | 152 | PREDICTED: prostaglandin E synthase [Papio anubis] |
| GI:386781181 | RefSeq | XP_008004152.1 | 152 | PREDICTED: prostaglandin E synthase [Chlorocebus sabaeus] |
| GI:386781181 | RefSeq | XP_010359233.1 | 152 | PREDICTED: prostaglandin E synthase [Rhinopithecus roxellana] |
Related Sequences to LMP014728 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781181 | GenBank | EHH23748.1 | 152 | hypothetical protein EGK_07286 [Macaca mulatta] |
| GI:386781181 | RefSeq | XP_003264284.1 | 152 | PREDICTED: prostaglandin E synthase [Nomascus leucogenys] |
| GI:386781181 | SwissProt | Q6PWL6.1 | 152 | RecName: Full=Prostaglandin E synthase; AltName: Full=Microsomal glutathione S-transferase 1-like 1; Short=MGST1-L1; AltName: Full=Microsomal prostaglandin E synthase 1; Short=MPGES-1 [Macaca fascicularis] |