Gene/Proteome Database (LMPD)
LMPD ID
LMP014680
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
palmitoyl-protein thioesterase 1
Gene Symbol
Alternate Names
palmitoyl-protein thioesterase 1; palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile);
Chromosome
1
Map Location
chromosome:1
Proteins
| palmitoyl-protein thioesterase 1 precursor | |
|---|---|
| Refseq ID | NP_001248261 |
| Protein GI | 386782345 |
| UniProt ID | F7HMC7 |
| mRNA ID | NM_001261332 |
| Length | 306 |
| Protein sequence is identical to GI:109002602 (mRNA isoform) | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2218 peptide sequence: MASPSCLWLLAVALLPWTCAA | |
| Refseq ID | XP_002801539 |
| Protein GI | 297278366 |
| UniProt ID | F7HMC7 |
| mRNA ID | XM_002801493 |
| Length | 282 |
| MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2218 peptide sequence: MASPSCLWLLAVALLPWTCAA | |
| Refseq ID | XP_001082462 |
| Protein GI | 109002602 |
| UniProt ID | F7HMC7 |
| mRNA ID | XM_002801493 |
| Length | 306 |
| MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2218 peptide sequence: MASPSCLWLLAVALLPWTCAA | |
| Refseq ID | XP_002801540 |
| Protein GI | 297278369 |
| UniProt ID | F7HMC7 |
| mRNA ID | XM_002801493 |
| Length | 263 |
| MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETTN | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2218 peptide sequence: MASPSCLWLLAVALLPWTCAA | |
| Refseq ID | XP_002801541 |
| Protein GI | 297278371 |
| UniProt ID | F7HMC7 |
| mRNA ID | XM_002801493 |
| Length | 203 |
| MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2218 peptide sequence: MASPSCLWLLAVALLPWTCAA | |
Gene Information
Entrez Gene ID
Gene Name
palmitoyl-protein thioesterase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
| GO:0030424 | IEA:Ensembl | C | axon |
| GO:0030425 | IEA:Ensembl | C | dendrite |
| GO:0005615 | IEA:Ensembl | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005764 | IEA:Ensembl | C | lysosome |
| GO:0045121 | IEA:Ensembl | C | membrane raft |
| GO:0043025 | IEA:Ensembl | C | neuronal cell body |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0008021 | IEA:Ensembl | C | synaptic vesicle |
| GO:0008474 | IEA:Ensembl | F | palmitoyl-(protein) hydrolase activity |
| GO:0008344 | IEA:Ensembl | P | adult locomotory behavior |
| GO:0006309 | IEA:Ensembl | P | apoptotic DNA fragmentation |
| GO:0008306 | IEA:Ensembl | P | associative learning |
| GO:0007420 | IEA:Ensembl | P | brain development |
| GO:0044257 | IEA:Ensembl | P | cellular protein catabolic process |
| GO:0051186 | IEA:Ensembl | P | cofactor metabolic process |
| GO:0051181 | IEA:Ensembl | P | cofactor transport |
| GO:0007625 | IEA:Ensembl | P | grooming behavior |
| GO:0016042 | IEA:Ensembl | P | lipid catabolic process |
| GO:0007042 | IEA:Ensembl | P | lysosomal lumen acidification |
| GO:0031579 | IEA:Ensembl | P | membrane raft organization |
| GO:0030308 | IEA:Ensembl | P | negative regulation of cell growth |
| GO:0043524 | IEA:Ensembl | P | negative regulation of neuron apoptotic process |
| GO:0007269 | IEA:Ensembl | P | neurotransmitter secretion |
| GO:0006907 | IEA:Ensembl | P | pinocytosis |
| GO:0048549 | IEA:Ensembl | P | positive regulation of pinocytosis |
| GO:0048260 | IEA:Ensembl | P | positive regulation of receptor-mediated endocytosis |
| GO:0002084 | IEA:Ensembl | P | protein depalmitoylation |
| GO:0015031 | IEA:Ensembl | P | protein transport |
| GO:0006898 | IEA:Ensembl | P | receptor-mediated endocytosis |
| GO:0032429 | IEA:Ensembl | P | regulation of phospholipase A2 activity |
| GO:0007601 | IEA:Ensembl | P | visual perception |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
palmitoyl-protein thioesterase 1
Protein Entry
F7HMC7_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014680 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109002602 | RefSeq | XP_001082462 | 306 | palmitoyl-protein thioesterase 1 |
| 297278366 | RefSeq | XP_002801539 | 282 | palmitoyl-protein thioesterase 1 |
| 297278369 | RefSeq | XP_002801540 | 263 | palmitoyl-protein thioesterase 1 |
| 297278371 | RefSeq | XP_002801541 | 203 | palmitoyl-protein thioesterase 1 |
Identical Sequences to LMP014680 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386782345 | GenBank | AFH33089.1 | 306 | palmitoyl-protein thioesterase 1 isoform 1 precursor [Macaca mulatta] |
| GI:386782345 | GenBank | AFI37637.1 | 306 | palmitoyl-protein thioesterase 1 isoform 1 precursor [Macaca mulatta] |
| GI:386782345 | RefSeq | NP_001270850.1 | 306 | palmitoyl-protein thioesterase 1 precursor [Macaca fascicularis] |
| GI:386782345 | RefSeq | XP_007977472.1 | 306 | PREDICTED: palmitoyl-protein thioesterase 1 [Chlorocebus sabaeus] |
Related Sequences to LMP014680 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386782345 | DBBJ | BAC20604.1 | 306 | palmitoyl-protein thioesterase [Macaca fascicularis] |
| GI:386782345 | SwissProt | Q8HXW6.1 | 306 | RecName: Full=Palmitoyl-protein thioesterase 1; Short=PPT-1; AltName: Full=Palmitoyl-protein hydrolase 1; Flags: Precursor [Macaca fascicularis] |