Gene/Proteome Database (LMPD)
Proteins
| phospholipid scramblase 3 | |
|---|---|
| Refseq ID | NP_001252817 |
| Protein GI | 388454051 |
| UniProt ID | F6U2A9 |
| mRNA ID | NM_001265888 |
| Length | 295 |
| Protein sequence is identical to GI:109113290 (mRNA isoform) | |
| Refseq ID | XP_001118026 |
| Protein GI | 109113290 |
| UniProt ID | F6U2A9 |
| mRNA ID | XM_001118026 |
| Length | 295 |
| MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPAPGQAPVPAQVPAPAPGFALFPSPGPVASGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREAFTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0071222 | IEA:Ensembl | P | cellular response to lipopolysaccharide |
| GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
| GO:0042593 | IEA:Ensembl | P | glucose homeostasis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005552 | Scramblase |
UniProt Annotations
Entry Information
Gene Name
phospholipid scramblase 3
Protein Entry
F6U2A9_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014636 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109113290 | RefSeq | XP_001118026 | 295 | phospholipid scramblase 3 |
Identical Sequences to LMP014636 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388454051 | RefSeq | XP_008008320.1 | 295 | PREDICTED: phospholipid scramblase 3 [Chlorocebus sabaeus] |
| GI:388454051 | RefSeq | XP_008008321.1 | 295 | PREDICTED: phospholipid scramblase 3 [Chlorocebus sabaeus] |
| GI:388454051 | RefSeq | XP_009187814.1 | 295 | PREDICTED: phospholipid scramblase 3 [Papio anubis] |
| GI:388454051 | RefSeq | XP_009187815.1 | 295 | PREDICTED: phospholipid scramblase 3 [Papio anubis] |
Related Sequences to LMP014636 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388454051 | GenBank | EHH24463.1 | 295 | Phospholipid scramblase 3 [Macaca mulatta] |