Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001094364 |
| Protein GI | 108998698 |
| UniProt ID | F7FSK4 |
| mRNA ID | XM_001094364 |
| Length | 142 |
| MKPPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSKRGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNRLCTGPTPPC | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IIE
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | IEA:InterPro | F | phospholipase A2 activity |
| GO:0016042 | IEA:InterPro | P | lipid catabolic process |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00590 | Arachidonic acid metabolism |
| mcc00590 | Arachidonic acid metabolism |
| ko00565 | Ether lipid metabolism |
| mcc00565 | Ether lipid metabolism |
| ko04975 | Fat digestion and absorption |
| mcc04975 | Fat digestion and absorption |
| ko00564 | Glycerophospholipid metabolism |
| mcc00564 | Glycerophospholipid metabolism |
| ko00591 | Linoleic acid metabolism |
| mcc00591 | Linoleic acid metabolism |
| mcc01100 | Metabolic pathways |
| ko04972 | Pancreatic secretion |
| mcc04972 | Pancreatic secretion |
| mcc04014 | Ras signaling pathway |
| ko04270 | Vascular smooth muscle contraction |
| mcc04270 | Vascular smooth muscle contraction |
| ko00592 | alpha-Linolenic acid metabolism |
| mcc00592 | alpha-Linolenic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IIE
Protein Entry
F7FSK4_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Cofactor | Note=Binds 1 calcium ion per subunit. ; |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted |
Identical and Related Proteins
Unique RefSeq proteins for LMP014594 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 108998698 | RefSeq | XP_001094364 | 142 | phospholipase A2, group IIE |
Identical Sequences to LMP014594 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:108998698 | RefSeq | XP_003891294.1 | 142 | PREDICTED: group IIE secretory phospholipase A2 [Papio anubis] |
| GI:108998698 | RefSeq | XP_005544625.1 | 142 | PREDICTED: group IIE secretory phospholipase A2 [Macaca fascicularis] |
Related Sequences to LMP014594 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:108998698 | GenBank | AGF22441.1 | 142 | Sequence 7 from patent US 8372594 |
| GI:108998698 | RefSeq | XP_010383840.1 | 142 | PREDICTED: group IIE secretory phospholipase A2 [Rhinopithecus roxellana] |