Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001094731 |
| Protein GI | 108998704 |
| UniProt ID | F7EHU8 |
| mRNA ID | XM_001094731 |
| Length | 144 |
| MKTLLLLAVIMIFGLLQAHGNLVDFRRMIKLKTGKEAALSYGFYGCHCGVGGKGAPKDATDRCCVVHDCCYKRLEKRGCGTKFLSYKFSNKGSTITCAKQDSCRSQLCECDKAAAYCFARNKSTYNKNYQYYSNKFCRGSTPRC | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0005615 | IEA:Ensembl | C | extracellular space |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | IEA:Ensembl | F | phospholipase A2 activity |
| GO:0005543 | IEA:Ensembl | F | phospholipid binding |
| GO:0016042 | IEA:InterPro | P | lipid catabolic process |
| GO:0050680 | IEA:Ensembl | P | negative regulation of epithelial cell proliferation |
| GO:0046473 | IEA:Ensembl | P | phosphatidic acid metabolic process |
| GO:0035019 | IEA:Ensembl | P | somatic stem cell maintenance |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00590 | Arachidonic acid metabolism |
| mcc00590 | Arachidonic acid metabolism |
| ko00565 | Ether lipid metabolism |
| mcc00565 | Ether lipid metabolism |
| ko04975 | Fat digestion and absorption |
| mcc04975 | Fat digestion and absorption |
| ko00564 | Glycerophospholipid metabolism |
| mcc00564 | Glycerophospholipid metabolism |
| ko00591 | Linoleic acid metabolism |
| mcc00591 | Linoleic acid metabolism |
| mcc01100 | Metabolic pathways |
| ko04972 | Pancreatic secretion |
| mcc04972 | Pancreatic secretion |
| mcc04014 | Ras signaling pathway |
| ko04270 | Vascular smooth muscle contraction |
| mcc04270 | Vascular smooth muscle contraction |
| ko00592 | alpha-Linolenic acid metabolism |
| mcc00592 | alpha-Linolenic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Protein Entry
F7EHU8_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
| Cofactor | Note=Binds 1 calcium ion per subunit. ; |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted |
Identical and Related Proteins
Unique RefSeq proteins for LMP014592 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 108998704 | RefSeq | XP_001094731 | 144 | phospholipase A2, group IIA (platelets, synovial fluid) |
Identical Sequences to LMP014592 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:108998704 | GenBank | EHH14401.1 | 144 | hypothetical protein EGK_00322 [Macaca mulatta] |
Related Sequences to LMP014592 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:108998704 | GenBank | EHH49604.1 | 144 | hypothetical protein EGM_00293 [Macaca fascicularis] |
| GI:108998704 | RefSeq | XP_005544624.1 | 144 | PREDICTED: phospholipase A2, membrane associated [Macaca fascicularis] |
| GI:108998704 | RefSeq | XP_009199061.1 | 144 | PREDICTED: phospholipase A2, membrane associated [Papio anubis] |