Gene/Proteome Database (LMPD)

LMPD ID
LMP014433
Gene ID
707483
Species
Macaca mulatta (Rhesus monkey)
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
NR2F2
Alternate Names
nuclear receptor subfamily 2, group F, member 2;
Chromosome
7
Map Location
chromosome:7

Proteins

Refseq ID XP_001099957
Protein GI 109082429
UniProt ID F7GRH7
mRNA ID XM_001099957
Length 414
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

Gene Information

Entrez Gene ID
707483
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
NR2F2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0004879 IEA:InterPro F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0001972 IEA:Ensembl F retinoic acid binding
GO:0043565 IEA:Ensembl F sequence-specific DNA binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0009952 IEA:Ensembl P anterior/posterior pattern specification
GO:0048514 IEA:Ensembl P blood vessel morphogenesis
GO:0009566 IEA:Ensembl P fertilization
GO:0030900 IEA:Ensembl P forebrain development
GO:0060173 IEA:Ensembl P limb development
GO:0001893 IEA:Ensembl P maternal placenta development
GO:0045736 IEA:Ensembl P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0010596 IEA:Ensembl P negative regulation of endothelial cell migration
GO:0001937 IEA:Ensembl P negative regulation of endothelial cell proliferation
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0001764 IEA:Ensembl P neuron migration
GO:0060674 IEA:Ensembl P placenta blood vessel development
GO:0045893 IEA:Ensembl P positive regulation of transcription, DNA-templated
GO:0009956 IEA:Ensembl P radial pattern formation
GO:0060849 IEA:Ensembl P regulation of transcription involved in lymphatic endothelial cell fate commitment
GO:0007519 IEA:Ensembl P skeletal muscle tissue development
GO:0060707 IEA:Ensembl P trophoblast giant cell differentiation

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001723 Steroid hormone receptor
IPR003068 Transcription factor COUP
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
nuclear receptor subfamily 2, group F, member 2
Protein Entry
F7GRH7_MACMU
UniProt ID
F7GRH7
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the nuclear hormone receptor family.
Similarity Contains nuclear receptor DNA-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014433 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109082429 RefSeq XP_001099957 414 nuclear receptor subfamily 2, group F, member 2

Identical Sequences to LMP014433 proteins

Reference Database Accession Length Protein Name
GI:109082429 GenBank JAB39974.1 414 COUP transcription factor 2 isoform a [Callithrix jacchus]
GI:109082429 RefSeq XP_005560624.1 414 PREDICTED: COUP transcription factor 2 isoform X2 [Macaca fascicularis]
GI:109082429 RefSeq XP_006984478.1 414 PREDICTED: COUP transcription factor 2-like [Peromyscus maniculatus bairdii]
GI:109082429 RefSeq XP_010359627.1 414 PREDICTED: COUP transcription factor 2 isoform X1 [Rhinopithecus roxellana]

Related Sequences to LMP014433 proteins

Reference Database Accession Length Protein Name
GI:109082429 DBBJ BAE24245.1 414 unnamed protein product [Mus musculus]
GI:109082429 RefSeq XP_003788693.1 414 PREDICTED: COUP transcription factor 2 [Otolemur garnettii]
GI:109082429 RefSeq XP_003901468.1 414 PREDICTED: COUP transcription factor 2 isoform X1 [Papio anubis]
GI:109082429 RefSeq XP_005083998.1 414 PREDICTED: COUP transcription factor 2 isoform X1 [Mesocricetus auratus]