LIPID MAPS

LMPD ID

LMP014429

Gene ID

Species

Macaca mulatta (Rhesus monkey)

Gene Name

nuclear receptor subfamily 1, group I, member 3

Gene Symbol

NR1I3

Synonyms

CAR;

Alternate Names

nuclear receptor subfamily 1 group I member 3; constitutive androstane receptor;

Chromosome

1

Map Location

chromosome:1

nuclear receptor subfamily 1 group I member 3
Refseq ID	NP_001028068
Protein GI	74136355
UniProt ID	Q8MIM3
mRNA ID	NM_001032896
Length	361
MTATPTRDVMASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKIQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPMQLSNEQEELIQTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADVNTFMVQQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDAARVSPAVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRHEIDQLQEEMALTLQSYIKGQQQRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS

Entrez Gene ID

Gene Name

nuclear receptor subfamily 1, group I, member 3

Gene Symbol

NR1I3

Species

Macaca mulatta

GO ID	Source	Type	Description
GO:0005737	ISS:UniProtKB	C	cytoplasm
GO:0005856	IEA:UniProtKB-KW	C	cytoskeleton
GO:0005829	IEA:Ensembl	C	cytosol
GO:0005634	ISS:UniProtKB	C	nucleus
GO:0000977	IEA:Ensembl	F	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001228	IEA:Ensembl	F	RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0003707	IEA:InterPro	F	steroid hormone receptor activity
GO:0004887	IEA:InterPro	F	thyroid hormone receptor activity
GO:0008270	IEA:InterPro	F	zinc ion binding
GO:0045892	IEA:Ensembl	P	negative regulation of transcription, DNA-templated

Accession	Description
IPR008946	Nuclear hormone receptor, ligand-binding
IPR000536	Nuclear hormone receptor, ligand-binding, core
IPR001723	Steroid hormone receptor
IPR001728	Thyroid hormone receptor
IPR013088	Zinc finger, NHR/GATA-type
IPR001628	Zinc finger, nuclear hormone receptor-type

Gene Name

nuclear receptor subfamily 1, group I, member 3

Protein Entry

NR1I3_MACMU

UniProt ID

Species

Rhesus monkey

Comment Type	Description
Domain	Composed by a short N-terminal domain followed by the DNA binding, hinge, and ligand binding/dimerization domains.
Function	Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element (By similarity).
Ptm	Phosphorylated at Thr-38 by PKC, dephosphorylation of Thr-38 is required for nuclear translocation and activation.
Sequence Caution	Sequence=AAM76230.1; Type=Erroneous initiation; Evidence= ;
Similarity	Belongs to the nuclear hormone receptor family. NR1 subfamily.
Similarity	Contains 1 nuclear receptor DNA-binding domain.
Subcellular Location	Nucleus {ECO:0000255\|PROSITE- ProRule:PRU00407}. Cytoplasm Cytoplasm, cytoskeleton Note=Recruited to the cytoplasm by DNAJC7.
Subunit	Heterodimer of NR1I3 and RXR. Interacts with PSMC4. Interacts with ECT2. Directly interacts with DNAJC7; this complex may also include HSP90 (By similarity).

Protein GI	Database	Accession	Length	Protein Name
74136355	RefSeq	NP_001028068	361	nuclear receptor subfamily 1 group I member 3

Reference	Database	Accession	Length	Protein Name
GI:74136355	GenBank	AAM76230.1	361	constitutive androstane receptor [Macaca mulatta]

Reference	Database	Accession	Length	Protein Name
GI:74136355	RefSeq	XP_005541247.1	352	PREDICTED: nuclear receptor subfamily 1 group I member 3 isoform X5 [Macaca fascicularis]
GI:74136355	RefSeq	XP_009183566.1	352	PREDICTED: nuclear receptor subfamily 1 group I member 3 isoform X3 [Papio anubis]
GI:74136355	SwissProt	Q8MIM3.2	352	RecName: Full=Nuclear receptor subfamily 1 group I member 3; AltName: Full=Constitutive androstane receptor; Short=CAR [Macaca mulatta]