Gene/Proteome Database (LMPD)

LMPD ID
LMP014428
Gene ID
574226
Species
Macaca mulatta (Rhesus monkey)
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
NR1I2
Synonyms
PXR;
Alternate Names
nuclear receptor subfamily 1 group I member 2; pregnane X receptor; orphan nuclear receptor PXR;
Chromosome
2
Map Location
chromosome:2

Proteins

nuclear receptor subfamily 1 group I member 2
Refseq ID NP_001028054
Protein GI 148753584
UniProt ID Q8SQ01
mRNA ID NM_001032882
Length 434
MEVRPKEGWNHADFVYCEDTEFAPGKPTVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEERRALIKRKKRERIGTQPPGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCEMPESLQAPSREEAAKWNQVRKDLWSVKVSVQLRGEDGSVWNYKPPADNGGKEIFSLLPHMADMSTYMFKGIINFAKVISYFRDLPIEDQISLLKGATFELCQLRFNTVFNAETGTWECGRLSYCLEDPAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVVQHRVVDQLQEQYAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Gene Information

Entrez Gene ID
574226
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
NR1I2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0008144 ISS:UniProtKB F drug binding
GO:0004879 ISS:UniProtKB F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0043565 IEA:InterPro F sequence-specific DNA binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0046618 ISS:UniProtKB P drug export
GO:0042738 ISS:UniProtKB P exogenous drug catabolic process
GO:0030522 ISS:GOC P intracellular receptor signaling pathway
GO:0045893 ISS:UniProtKB P positive regulation of transcription, DNA-templated
GO:0006805 ISS:UniProtKB P xenobiotic metabolic process
GO:0042908 ISS:UniProtKB P xenobiotic transport

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
nuclear receptor subfamily 1, group I, member 2
Protein Entry
NR1I2_MACMU
UniProt ID
Q8SQ01
Species
Rhesus monkey

Comments

Comment Type Description
Function Nuclear receptor that binds and is activated by a variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, endogenous compounds and drugs. Response to specific ligands is species-specific, due to differences in the ligand- binding domain. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes (By similarity).
Similarity Belongs to the nuclear hormone receptor family. NR1 subfamily.
Similarity Contains 1 nuclear receptor DNA-binding domain.
Subcellular Location Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}.
Subunit Heterodimer with RXRA. Interacts with NCOA1 (By similarity).

Identical and Related Proteins

Unique RefSeq proteins for LMP014428 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
148753584 RefSeq NP_001028054 434 nuclear receptor subfamily 1 group I member 2

Identical Sequences to LMP014428 proteins

Reference Database Accession Length Protein Name
GI:148753584 GenBank AAM10633.1 434 pregnane X receptor [Macaca mulatta]
GI:148753584 SwissProt Q8SQ01.1 434 RecName: Full=Nuclear receptor subfamily 1 group I member 2; AltName: Full=Orphan nuclear receptor PXR; AltName: Full=Pregnane X receptor [Macaca mulatta]

Related Sequences to LMP014428 proteins

Reference Database Accession Length Protein Name
GI:148753584 GenBank ADB12158.1 434 nuclear receptor subfamily 1 group I member 2 [synthetic construct]
GI:148753584 GenBank EHH16093.1 473 hypothetical protein EGK_11330 [Macaca mulatta]