Gene/Proteome Database (LMPD)
Proteins
| lecithin retinol acyltransferase precursor | |
|---|---|
| Refseq ID | NP_001180868 |
| Protein GI | 302565154 |
| UniProt ID | F6ZN79 |
| mRNA ID | NM_001193939 |
| Length | 230 |
| Protein sequence is identical to GI:109075991 (mRNA isoform) | |
| sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3367 peptide sequence: MKNPMLEVVSLLLEKLLLISNFTLFSSGATG | |
| Refseq ID | XP_001092118 |
| Protein GI | 109075991 |
| UniProt ID | F6ZN79 |
| mRNA ID | XM_001092118 |
| Length | 230 |
| MKNPMLEVVSLLLEKLLLISNFTLFSSGATGEDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVRVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEEVARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDKFCETVKIIIRDQRSVLASAVLGLASIVCTGLVSYTTLPAIFIPFFLWMAG | |
| sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3367 peptide sequence: MKNPMLEVVSLLLEKLLLISNFTLFSSGATG | |
Gene Information
Entrez Gene ID
Gene Name
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008374 | IEA:Ensembl | F | O-acyltransferase activity |
| GO:0006776 | IEA:Ensembl | P | vitamin A metabolic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007053 | LRAT-like domain |
UniProt Annotations
Entry Information
Gene Name
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
Protein Entry
F6ZN79_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014323 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109075991 | RefSeq | XP_001092118 | 230 | lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase) |
Identical Sequences to LMP014323 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302565154 | GenBank | EHH26259.1 | 230 | hypothetical protein EGK_16178 [Macaca mulatta] |
| GI:302565154 | GenBank | EHH54028.1 | 230 | hypothetical protein EGM_14764 [Macaca fascicularis] |
| GI:302565154 | RefSeq | XP_005556190.1 | 230 | PREDICTED: lecithin retinol acyltransferase [Macaca fascicularis] |
| GI:302565154 | RefSeq | XP_007998249.1 | 230 | PREDICTED: lecithin retinol acyltransferase [Chlorocebus sabaeus] |
Related Sequences to LMP014323 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|