Gene/Proteome Database (LMPD)

LMPD ID
LMP014323
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
Gene Symbol
Alternate Names
lecithin retinol acyltransferase;
Chromosome
5
Map Location
chromosome:5

Proteins

lecithin retinol acyltransferase precursor
Refseq ID NP_001180868
Protein GI 302565154
UniProt ID F6ZN79
mRNA ID NM_001193939
Length 230
Protein sequence is identical to GI:109075991 (mRNA isoform)
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3367 peptide sequence: MKNPMLEVVSLLLEKLLLISNFTLFSSGATG
Refseq ID XP_001092118
Protein GI 109075991
UniProt ID F6ZN79
mRNA ID XM_001092118
Length 230
MKNPMLEVVSLLLEKLLLISNFTLFSSGATGEDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVRVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEEVARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDKFCETVKIIIRDQRSVLASAVLGLASIVCTGLVSYTTLPAIFIPFFLWMAG
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3367 peptide sequence: MKNPMLEVVSLLLEKLLLISNFTLFSSGATG

Gene Information

Entrez Gene ID
Gene Name
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008374 IEA:Ensembl F O-acyltransferase activity
GO:0006776 IEA:Ensembl P vitamin A metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00830 Retinol metabolism
mcc00830 Retinol metabolism
ko04977 Vitamin digestion and absorption
mcc04977 Vitamin digestion and absorption

Domain Information

InterPro Annotations

Accession Description
IPR007053 LRAT-like domain

UniProt Annotations

Entry Information

Gene Name
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
Protein Entry
F6ZN79_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014323 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109075991 RefSeq XP_001092118 230 lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)

Identical Sequences to LMP014323 proteins

Reference Database Accession Length Protein Name
GI:302565154 GenBank EHH26259.1 230 hypothetical protein EGK_16178 [Macaca mulatta]
GI:302565154 GenBank EHH54028.1 230 hypothetical protein EGM_14764 [Macaca fascicularis]
GI:302565154 RefSeq XP_005556190.1 230 PREDICTED: lecithin retinol acyltransferase [Macaca fascicularis]
GI:302565154 RefSeq XP_007998249.1 230 PREDICTED: lecithin retinol acyltransferase [Chlorocebus sabaeus]

Related Sequences to LMP014323 proteins

Reference Database Accession Length Protein Name