Gene/Proteome Database (LMPD)

LMPD ID
LMP014084
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
Alternate Names
fatty acid-binding protein, brain;
Chromosome
4
Map Location
chromosome:4

Proteins

fatty acid-binding protein, brain
Refseq ID NP_001244643
Protein GI 383872943
UniProt ID F6TB55
mRNA ID NM_001257714
Length 132
Protein sequence is identical to GI:109072829 (mRNA isoform)
Refseq ID XP_001108559
Protein GI 109072829
UniProt ID F6TB55
mRNA ID XM_001108559
Length 132
MVEAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFHLGEEFDETTADDRNCKSVVSLDGDKLVHVQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042995 IEA:Ensembl C cell projection
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0021846 IEA:Ensembl P cell proliferation in forebrain
GO:0022008 IEA:Ensembl P neurogenesis
GO:0060134 IEA:Ensembl P prepulse inhibition

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 7, brain
Protein Entry
F6TB55_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014084 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109072829 RefSeq XP_001108559 132 fatty acid binding protein 7, brain

Identical Sequences to LMP014084 proteins

Reference Database Accession Length Protein Name
GI:383872943 GenBank JAB43324.1 132 fatty acid-binding protein, brain [Callithrix jacchus]
GI:383872943 RefSeq NP_001270567.1 132 uncharacterized protein LOC101865805 [Macaca fascicularis]
GI:383872943 RefSeq XP_008005375.1 132 PREDICTED: fatty acid-binding protein, brain isoform X2 [Chlorocebus sabaeus]
GI:383872943 RefSeq XP_010373711.1 132 PREDICTED: fatty acid-binding protein, brain [Rhinopithecus roxellana]

Related Sequences to LMP014084 proteins

Reference Database Accession Length Protein Name
GI:383872943 GenBank EHH53419.1 132 hypothetical protein EGM_14055 [Macaca fascicularis]
GI:383872943 RefSeq XP_002746967.1 132 PREDICTED: fatty acid-binding protein, brain [Callithrix jacchus]