Gene/Proteome Database (LMPD)

LMPD ID
LMP014083
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
fatty acid binding protein 6, ileal
Gene Symbol
Alternate Names
fatty acid binding protein 6, ileal; fatty acid binding protein 6, ileal (gastrotropin);
Chromosome
6
Map Location
chromosome:6

Proteins

Refseq ID XP_001083965
Protein GI 297295610
mRNA ID XM_001083965
Length 151
MGEPERRPAENETDKERKGPPSSMAFTGKFEMESEKNYDEFMKLLGLSSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESDIQTMGGKKFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Refseq ID XP_001083748
Protein GI 109079592
UniProt ID F6UZ52
mRNA ID XM_001083965
Length 128
MAFTGKFEMESEKNYDEFMKLLGLSSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESDIQTMGGKKFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 6, ileal
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 6, ileal
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014083 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297295610 RefSeq XP_001083965 151
109079592 RefSeq XP_001083748 128 fatty acid binding protein 6, ileal

Identical Sequences to LMP014083 proteins

Reference Database Accession Length Protein Name
GI:109079592 RefSeq XP_005558484.1 128 PREDICTED: gastrotropin [Macaca fascicularis]

Related Sequences to LMP014083 proteins

Reference Database Accession Length Protein Name
GI:109079592 GenBank EHH26995.1 177 hypothetical protein EGK_17089 [Macaca mulatta]
GI:109079592 GenBank EHH54723.1 177 hypothetical protein EGM_15615 [Macaca fascicularis]
GI:109079592 RefSeq XP_006714891.1 177 PREDICTED: gastrotropin isoform X1 [Homo sapiens]
GI:109079592 RefSeq XP_010368226.1 142 PREDICTED: gastrotropin isoform X2 [Rhinopithecus roxellana]