Gene/Proteome Database (LMPD)

LMPD ID
LMP014082
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
fatty acid binding protein 5 (psoriasis-associated)
Gene Symbol
Alternate Names
fatty acid-binding protein, epidermal; Epidermal-type fatty acid-binding protein;
Chromosome
8
Map Location
chromosome:8

Proteins

fatty acid-binding protein, epidermal
Refseq ID NP_001247718
Protein GI 386782111
UniProt ID F6YIY5
mRNA ID NM_001260789
Length 135
Protein sequence is identical to GI:109086783 (mRNA isoform)
Refseq ID XP_001091773
Protein GI 109086783
UniProt ID F6YIY5
mRNA ID XM_001091773
Length 135
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCSFTDGALVQHQEWDGKESTITRKLKDGKLVVDCVMNNVTCTRIYEKVE

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 5 (psoriasis-associated)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:InterPro F lipid binding
GO:0005215 IEA:InterPro F transporter activity

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 5 (psoriasis-associated)
Protein Entry
F6YIY5_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014082 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109086783 RefSeq XP_001091773 135 fatty acid binding protein 5 (psoriasis-associated)

Identical Sequences to LMP014082 proteins

Reference Database Accession Length Protein Name
GI:386782111 RefSeq XP_003902954.1 135 PREDICTED: fatty acid-binding protein, epidermal [Papio anubis]
GI:386782111 RefSeq XP_003907278.1 135 PREDICTED: fatty acid-binding protein, epidermal [Papio anubis]
GI:386782111 RefSeq XP_005563674.1 135 PREDICTED: fatty acid-binding protein, epidermal [Macaca fascicularis]
GI:386782111 RefSeq XP_007999156.1 135 PREDICTED: fatty acid-binding protein, epidermal [Chlorocebus sabaeus]

Related Sequences to LMP014082 proteins

Reference Database Accession Length Protein Name
GI:386782111 GenBank AFE77130.1 135 fatty acid-binding protein, epidermal [Macaca mulatta]
GI:386782111 GenBank AFH29415.1 135 fatty acid-binding protein, epidermal [Macaca mulatta]
GI:386782111 GenBank AFI35784.1 135 fatty acid-binding protein, epidermal [Macaca mulatta]