Gene/Proteome Database (LMPD)
Proteins
| fatty acid 2-hydroxylase | |
|---|---|
| Refseq ID | NP_001181351 |
| Protein GI | 302564903 |
| UniProt ID | F7HMN1 |
| mRNA ID | NM_001194422 |
| Length | 372 |
| Protein sequence is identical to GI:109129204 (mRNA isoform) | |
| Refseq ID | XP_001108607 |
| Protein GI | 109129204 |
| UniProt ID | F7HMN1 |
| mRNA ID | XM_001108607 |
| Length | 372 |
| MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEAVALEETQKTDPAMEPRFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLIPEKPHLKTQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0080132 | IEA:Ensembl | F | fatty acid alpha-hydroxylase activity |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0032286 | IEA:Ensembl | P | central nervous system myelin maintenance |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0030258 | IEA:Ensembl | P | lipid modification |
| GO:0032287 | IEA:Ensembl | P | peripheral nervous system myelin maintenance |
| GO:0042127 | IEA:Ensembl | P | regulation of cell proliferation |
| GO:0042634 | IEA:Ensembl | P | regulation of hair cycle |
| GO:0001949 | IEA:Ensembl | P | sebaceous gland cell differentiation |
| GO:0006665 | IEA:InterPro | P | sphingolipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acid 2-hydroxylase
Protein Entry
F7HMN1_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Contains 1 cytochrome b5 heme-binding domain. |
| Similarity | Contains cytochrome b5 heme-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014078 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109129204 | RefSeq | XP_001108607 | 372 | fatty acid 2-hydroxylase |
Identical Sequences to LMP014078 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302564903 | DBBJ | BAE01931.1 | 372 | unnamed protein product [Macaca fascicularis] |
| GI:302564903 | RefSeq | NP_001270612.1 | 372 | fatty acid 2-hydroxylase [Macaca fascicularis] |
| GI:302564903 | SwissProt | Q4R4P4.1 | 372 | RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Macaca fascicularis] |
Related Sequences to LMP014078 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302564903 | RefSeq | XP_010381264.1 | 372 | PREDICTED: fatty acid 2-hydroxylase [Rhinopithecus roxellana] |