Gene/Proteome Database (LMPD)
LMPD ID
LMP014054
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Alternate Names
elongation of very long chain fatty acids protein 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast);
Chromosome
5
Map Location
chromosome:5
EC Number
2.3.1.199
Proteins
| elongation of very long chain fatty acids protein 6 | |
|---|---|
| Refseq ID | NP_001253850 |
| Protein GI | 388454170 |
| UniProt ID | G7MTM8 |
| mRNA ID | NM_001266921 |
| Length | 265 |
| Protein sequence is identical to GI:109075349 (mRNA isoform) | |
| Refseq ID | XP_001089527 |
| Protein GI | 109075349 |
| UniProt ID | G7MTM8 |
| mRNA ID | XM_001089527 |
| Length | 265 |
| MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFVFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYSVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFYWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE | |
| Refseq ID | XP_001089764 |
| Protein GI | 109075353 |
| UniProt ID | G7MTM8 |
| mRNA ID | XM_001089527 |
| Length | 265 |
| Protein sequence is identical to GI:109075349 (mRNA isoform) | |
| Refseq ID | XP_001089649 |
| Protein GI | 109075351 |
| UniProt ID | G7MTM8 |
| mRNA ID | XM_001089527 |
| Length | 265 |
| Protein sequence is identical to GI:109075349 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
ELOVL fatty acid elongase 6
Protein Entry
G7MTM8_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014054 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109075349 | RefSeq | XP_001089527 | 265 | ELOVL fatty acid elongase 6 |
Identical Sequences to LMP014054 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388454170 | GenBank | AFE66210.1 | 265 | elongation of very long chain fatty acids protein 6 [Macaca mulatta] |
| GI:388454170 | RefSeq | XP_005555746.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 [Macaca fascicularis] |
| GI:388454170 | RefSeq | XP_007997733.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 [Chlorocebus sabaeus] |
| GI:388454170 | RefSeq | XP_007997734.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 [Chlorocebus sabaeus] |
Related Sequences to LMP014054 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388454170 | GenBank | EHH26124.1 | 265 | hypothetical protein EGK_16016 [Macaca mulatta] |