Gene/Proteome Database (LMPD)
Proteins
| cellular retinoic acid-binding protein 2 | |
|---|---|
| Refseq ID | NP_001253818 |
| Protein GI | 388453805 |
| UniProt ID | F7AFL8 |
| mRNA ID | NM_001266889 |
| Length | 138 |
| Protein sequence is identical to GI:109017380 (mRNA isoform) | |
| Refseq ID | XP_001116699 |
| Protein GI | 109017380 |
| UniProt ID | F7AFL8 |
| mRNA ID | XM_001116699 |
| Length | 138 |
| MPNFSGNWKIIRSENFEDLLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE | |
Gene Information
Entrez Gene ID
Gene Name
cellular retinoic acid binding protein 2
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:Ensembl | C | cytoplasm |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0001972 | IEA:Ensembl | F | retinoic acid binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0035115 | IEA:Ensembl | P | embryonic forelimb morphogenesis |
| GO:0042573 | IEA:Ensembl | P | retinoic acid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cellular retinoic acid binding protein 2
Protein Entry
F7AFL8_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013945 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109017380 | RefSeq | XP_001116699 | 138 | cellular retinoic acid binding protein 2 |
Identical Sequences to LMP013945 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388453805 | RefSeq | XP_005541477.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 [Macaca fascicularis] |
| GI:388453805 | RefSeq | XP_007974922.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 [Chlorocebus sabaeus] |
| GI:388453805 | RefSeq | XP_009181948.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 [Papio anubis] |
| GI:388453805 | RefSeq | XP_010354709.1 | 138 | PREDICTED: cellular retinoic acid-binding protein 2 [Rhinopithecus roxellana] |
Related Sequences to LMP013945 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388453805 | GenBank | EHH15353.1 | 138 | hypothetical protein EGK_01429 [Macaca mulatta] |
| GI:388453805 | GenBank | EHH50377.1 | 138 | hypothetical protein EGM_01196 [Macaca fascicularis] |