Gene/Proteome Database (LMPD)

LMPD ID
LMP013945
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
cellular retinoic acid binding protein 2
Gene Symbol
Alternate Names
cellular retinoic acid-binding protein 2;
Chromosome
1
Map Location
chromosome:1

Proteins

cellular retinoic acid-binding protein 2
Refseq ID NP_001253818
Protein GI 388453805
UniProt ID F7AFL8
mRNA ID NM_001266889
Length 138
Protein sequence is identical to GI:109017380 (mRNA isoform)
Refseq ID XP_001116699
Protein GI 109017380
UniProt ID F7AFL8
mRNA ID XM_001116699
Length 138
MPNFSGNWKIIRSENFEDLLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Gene Information

Entrez Gene ID
Gene Name
cellular retinoic acid binding protein 2
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:Ensembl C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005634 IEA:Ensembl C nucleus
GO:0001972 IEA:Ensembl F retinoic acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0035115 IEA:Ensembl P embryonic forelimb morphogenesis
GO:0042573 IEA:Ensembl P retinoic acid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
cellular retinoic acid binding protein 2
Protein Entry
F7AFL8_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013945 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109017380 RefSeq XP_001116699 138 cellular retinoic acid binding protein 2

Identical Sequences to LMP013945 proteins

Reference Database Accession Length Protein Name
GI:388453805 RefSeq XP_005541477.1 138 PREDICTED: cellular retinoic acid-binding protein 2 [Macaca fascicularis]
GI:388453805 RefSeq XP_007974922.1 138 PREDICTED: cellular retinoic acid-binding protein 2 [Chlorocebus sabaeus]
GI:388453805 RefSeq XP_009181948.1 138 PREDICTED: cellular retinoic acid-binding protein 2 [Papio anubis]
GI:388453805 RefSeq XP_010354709.1 138 PREDICTED: cellular retinoic acid-binding protein 2 [Rhinopithecus roxellana]

Related Sequences to LMP013945 proteins

Reference Database Accession Length Protein Name
GI:388453805 GenBank EHH15353.1 138 hypothetical protein EGK_01429 [Macaca mulatta]
GI:388453805 GenBank EHH50377.1 138 hypothetical protein EGM_01196 [Macaca fascicularis]