Gene/Proteome Database (LMPD)

LMPD ID
LMP013937
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
Alternate Names
coenzyme Q7 homolog, ubiquinone (yeast);
Chromosome
20
Map Location
chromosome:20

Proteins

Refseq ID XP_001083388
Protein GI 109127736
UniProt ID F7HMG3
mRNA ID XM_001083388
Length 217
MSCAGAAAAPCLWRLRPGARRSLSAYGRRIIVRFRSSGMTLDNINRAVVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFSELMVTFRVRPTVLMPFWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRKLMEEDPEKYKELLQVIKKFRDEELEHHDTGLEHDAELAPAYAVLKSVIQAGCKVAIYLSERL

Gene Information

Entrez Gene ID
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0055114 IEA:InterPro P oxidation-reduction process
GO:0006744 IEA:InterPro P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00130 Ubiquinone and other terpenoid-quinone biosynthesis
mcc00130 Ubiquinone and other terpenoid-quinone biosynthesis
M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone
mcc_M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

Domain Information

InterPro Annotations

Accession Description
IPR009078 Ferritin-like superfamily
IPR012347 Ferritin-related
IPR011566 Ubiquinone biosynthesis protein Coq7

UniProt Annotations

Entry Information

Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Protein Entry
F7HMG3_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013937 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109127736 RefSeq XP_001083388 217 coenzyme Q7 homolog, ubiquinone (yeast)

Identical Sequences to LMP013937 proteins

Reference Database Accession Length Protein Name
GI:109127736 RefSeq XP_005591409.1 217 PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X1 [Macaca fascicularis]

Related Sequences to LMP013937 proteins

Reference Database Accession Length Protein Name
GI:109127736 GenBank EHH31468.1 217 hypothetical protein EGK_12551 [Macaca mulatta]
GI:109127736 RefSeq XP_003916653.1 217 PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X1 [Papio anubis]
GI:109127736 RefSeq XP_007984952.1 217 PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X1 [Chlorocebus sabaeus]