Gene/Proteome Database (LMPD)
Proteins
| cannabinoid receptor 1 | |
|---|---|
| Refseq ID | NP_001027997 |
| Protein GI | 74136211 |
| UniProt ID | Q71SP5 |
| mRNA ID | NM_001032825 |
| Length | 472 |
| MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL | |
Gene Information
Entrez Gene ID
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0004949 | ISS:UniProtKB | F | cannabinoid receptor activity |
| GO:0007188 | ISS:UniProtKB | P | adenylate cyclase-modulating G-protein coupled receptor signaling pathway |
| GO:0038171 | ISS:GOC | P | cannabinoid signaling pathway |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
cannabinoid receptor 1 (brain)
Protein Entry
CNR1_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current (By similarity). |
| Ptm | Palmitoylation at Cys-415 is important for recruitment at both plasma membrane and lipid rafts. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. |
| Subcellular Location | Cell membrane ; Multi-pass membrane protein |
| Subunit | Interacts (via C-terminus) with CNRIP1. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013929 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 74136211 | RefSeq | NP_001027997 | 472 | cannabinoid receptor 1 |
Identical Sequences to LMP013929 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:74136211 | RefSeq | XP_010360494.1 | 472 | PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana] |
| GI:74136211 | RefSeq | XP_010360495.1 | 472 | PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana] |
| GI:74136211 | RefSeq | XP_010360496.1 | 472 | PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana] |
| GI:74136211 | RefSeq | XP_010360497.1 | 472 | PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana] |
Related Sequences to LMP013929 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:74136211 | EMBL | CAA38699.1 | 472 | cannabinoid receptor [Homo sapiens] |
| GI:74136211 | GenBank | AFE63879.1 | 472 | cannabinoid receptor 1 isoform a [Macaca mulatta] |
| GI:74136211 | RefSeq | XP_005248707.1 | 472 | PREDICTED: cannabinoid receptor 1 isoform X2 [Homo sapiens] |
| GI:74136211 | SwissProt | P21554.1 | 472 | RecName: Full=Cannabinoid receptor 1; Short=CB-R; Short=CB1; AltName: Full=CANN6 [Homo sapiens] |