Gene/Proteome Database (LMPD)

LMPD ID
LMP013846
Gene ID
703751
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol
ATP5G2
Alternate Names
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9);
Chromosome
11
Map Location
chromosome:11

Proteins

Refseq ID XP_001106939
Protein GI 109096969
UniProt ID F7H2N0
mRNA ID XM_001107007
Length 141
MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDEGLSSLAVSRPLTSLVSSRSFQTSATSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Refseq ID XP_001107007
Protein GI 109096967
UniProt ID F7H2N0
mRNA ID XM_001107007
Length 198
MPELILYVAITLSVVERLVGPGHACAEPSFRYSRCSAPLRLLCSGRSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDEGLSSLAVSRPLTSLVSSRSFQTSATSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Gene Information

Entrez Gene ID
703751
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol
ATP5G2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0045263 IEA:UniProtKB-KW C proton-transporting ATP synthase complex, coupling factor F(o)
GO:0015078 IEA:InterPro F hydrogen ion transmembrane transporter activity
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0015991 IEA:InterPro P ATP hydrolysis coupled proton transport
GO:0015986 IEA:InterPro P ATP synthesis coupled proton transport

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
mcc05010 Alzheimer's disease
M00158 F-type ATPase, eukaryotes
mcc_M00158 F-type ATPase, eukaryotes
ko05016 Huntington's disease
mcc05016 Huntington's disease
mcc01100 Metabolic pathways
ko00190 Oxidative phosphorylation
mcc00190 Oxidative phosphorylation
mcc05012 Parkinson's disease

Domain Information

InterPro Annotations

Accession Description
IPR000454 ATPase, F0 complex, subunit C
IPR020537 ATPase, F0 complex, subunit C, DCCD-binding site
IPR002379 V-ATPase proteolipid subunit C-like domain

UniProt Annotations

Entry Information

Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Protein Entry
F7H2N0_MACMU
UniProt ID
F7H2N0
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the ATPase C chain family.

Identical and Related Proteins

Unique RefSeq proteins for LMP013846 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109096967 RefSeq XP_001107007 198 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
109096969 RefSeq XP_001106939 141 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)

Identical Sequences to LMP013846 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013846 proteins

Reference Database Accession Length Protein Name
GI:109096969 GenBank EHH20790.1 198 ATP synthase proteolipid P2, partial [Macaca mulatta]
GI:109096969 GenBank AFJ70366.1 198 ATP synthase lipid-binding protein, mitochondrial isoform b precursor [Macaca mulatta]
GI:109096969 RefSeq XP_004089669.1 198 PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Nomascus leucogenys]
GI:109096969 RefSeq XP_005571096.1 198 PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca fascicularis]