Gene/Proteome Database (LMPD)

LMPD ID
LMP013813
Gene ID
696726
Species
Macaca mulatta (Rhesus monkey)
Gene Name
apolipoprotein C-III
Gene Symbol
APOC3
Alternate Names
apolipoprotein C-III;
Chromosome
14
Map Location
chromosome:14

Proteins

Refseq ID XP_001090312
Protein GI 109108764
UniProt ID F7FQN1
mRNA ID XM_001090312
Length 99
MQPRVLLVAALLSLLASARASEAEDTSLLGFMQDYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA

Gene Information

Entrez Gene ID
696726
Gene Name
apolipoprotein C-III
Gene Symbol
APOC3
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042627 IEA:Ensembl C chylomicron
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034363 IEA:Ensembl C intermediate-density lipoprotein particle
GO:0034366 IEA:Ensembl C spherical high-density lipoprotein particle
GO:0034361 IEA:Ensembl C very-low-density lipoprotein particle
GO:0055102 IEA:Ensembl F lipase inhibitor activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0007186 IEA:Ensembl P G-protein coupled receptor signaling pathway
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0034382 IEA:Ensembl P chylomicron remnant clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0042157 IEA:InterPro P lipoprotein metabolic process
GO:0060621 IEA:Ensembl P negative regulation of cholesterol import
GO:0045717 IEA:Ensembl P negative regulation of fatty acid biosynthetic process
GO:0010987 IEA:Ensembl P negative regulation of high-density lipoprotein particle clearance
GO:0051005 IEA:Ensembl P negative regulation of lipoprotein lipase activity
GO:0010989 IEA:Ensembl P negative regulation of low-density lipoprotein particle clearance
GO:0048261 IEA:Ensembl P negative regulation of receptor-mediated endocytosis
GO:0010897 IEA:Ensembl P negative regulation of triglyceride catabolic process
GO:0010916 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle clearance
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0032489 IEA:Ensembl P regulation of Cdc42 protein signal transduction
GO:0019433 IEA:Ensembl P triglyceride catabolic process
GO:0070328 IEA:Ensembl P triglyceride homeostasis
GO:0006642 IEA:Ensembl P triglyceride mobilization

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR008403 Apolipoprotein CIII

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-III
Protein Entry
F7FQN1_MACMU
UniProt ID
F7FQN1
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013813 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109108764 RefSeq XP_001090312 99 apolipoprotein C-III

Identical Sequences to LMP013813 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013813 proteins

Reference Database Accession Length Protein Name
GI:109108764 EMBL CAA48419.1 99 apolipoprotein C-III [Macaca fascicularis]
GI:109108764 GenBank AGU37455.1 99 Sequence 6 from patent US 8507444
GI:109108764 GenBank AGY24867.1 99 Sequence 6 from patent US 8557513
GI:109108764 SwissProt P18659.2 99 RecName: Full=Apolipoprotein C-III; Short=Apo-CIII; Short=ApoC-III; AltName: Full=Apolipoprotein C3; Flags: Precursor [Macaca fascicularis]