Gene/Proteome Database (LMPD)

LMPD ID
LMP013805
Gene ID
719946
Species
Macaca mulatta (Rhesus monkey)
Gene Name
apolipoprotein A-II
Gene Symbol
APOA2
Alternate Names
apolipoprotein A-II;
Chromosome
1
Map Location
chromosome:1

Proteins

Refseq ID XP_001117975
Protein GI 109017814
UniProt ID F6SD23
mRNA ID XM_001117975
Length 100
MKLLAATVLLLTICSLEGALVRRQAEEPSVESLVSQYFQTVTDYGKDLMEKVKSPELQAQAKAYFEKSKEQLTPLVKKAGTDLVNFLSYFVELRTQPATQ

Gene Information

Entrez Gene ID
719946
Gene Name
apolipoprotein A-II
Gene Symbol
APOA2
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0072562 IEA:Ensembl C blood microparticle
GO:0042627 IEA:Ensembl C chylomicron
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034366 IEA:Ensembl C spherical high-density lipoprotein particle
GO:0034361 IEA:Ensembl C very-low-density lipoprotein particle
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0017127 IEA:Ensembl F cholesterol transporter activity
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0055102 IEA:Ensembl F lipase inhibitor activity
GO:0031210 IEA:Ensembl F phosphatidylcholine binding
GO:0060228 IEA:Ensembl F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0046340 IEA:Ensembl P diacylglycerol catabolic process
GO:0034380 IEA:Ensembl P high-density lipoprotein particle assembly
GO:0034384 IEA:Ensembl P high-density lipoprotein particle clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0042157 IEA:Ensembl P lipoprotein metabolic process
GO:0034374 IEA:Ensembl P low-density lipoprotein particle remodeling
GO:0060621 IEA:Ensembl P negative regulation of cholesterol import
GO:0060695 IEA:Ensembl P negative regulation of cholesterol transporter activity
GO:0002740 IEA:Ensembl P negative regulation of cytokine secretion involved in immune response
GO:0060192 IEA:Ensembl P negative regulation of lipase activity
GO:0050995 IEA:Ensembl P negative regulation of lipid catabolic process
GO:0010903 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle remodeling
GO:0018206 IEA:Ensembl P peptidyl-methionine modification
GO:0006656 IEA:Ensembl P phosphatidylcholine biosynthetic process
GO:0009395 IEA:Ensembl P phospholipid catabolic process
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0010873 IEA:Ensembl P positive regulation of cholesterol esterification
GO:0045416 IEA:Ensembl P positive regulation of interleukin-8 biosynthetic process
GO:0050996 IEA:Ensembl P positive regulation of lipid catabolic process
GO:0006457 IEA:Ensembl P protein folding
GO:0018158 IEA:Ensembl P protein oxidation
GO:0030300 IEA:Ensembl P regulation of intestinal cholesterol absorption
GO:0031647 IEA:Ensembl P regulation of protein stability
GO:0009749 IEA:Ensembl P response to glucose
GO:0043691 IEA:Ensembl P reverse cholesterol transport
GO:0034370 IEA:Ensembl P triglyceride-rich lipoprotein particle remodeling

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR006801 Apolipoprotein A-II (ApoA-II)

UniProt Annotations

Entry Information

Gene Name
apolipoprotein A-II
Protein Entry
F6SD23_MACMU
UniProt ID
F6SD23
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013805 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109017814 RefSeq XP_001117975 100 apolipoprotein A-II

Identical Sequences to LMP013805 proteins

Reference Database Accession Length Protein Name
GI:109017814 GenBank EHH15444.1 100 hypothetical protein EGK_01534 [Macaca mulatta]
GI:109017814 GenBank EHH50465.1 100 hypothetical protein EGM_01298 [Macaca fascicularis]
GI:109017814 RefSeq XP_005541251.1 100 PREDICTED: apolipoprotein A-II [Macaca fascicularis]
GI:109017814 RefSeq XP_010365434.1 100 PREDICTED: apolipoprotein A-II [Rhinopithecus roxellana]

Related Sequences to LMP013805 proteins

Reference Database Accession Length Protein Name
GI:109017814 EMBL CAA48420.1 100 apolipoprotein A-II [Macaca fascicularis]