Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001103401 |
| Protein GI | 109016100 |
| UniProt ID | F7E6S3 |
| mRNA ID | XM_001103401 |
| Length | 345 |
| MSASGGKMGPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRAFQERTQQDLLKSLRAALSGNLERIVMALLQPAARFDAQELRTALKASDSAVDVAIEILATRTPPRLQECLAVYKHDFQVEAVDDITSQTNGILRDLLLALVKGGRDSYSGIIDYNLAEQDVRALQRAEGPSTEETWVPLLTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQAALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009986 | IEA:Ensembl | C | cell surface |
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0015464 | IEA:Ensembl | F | acetylcholine receptor activity |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0005544 | IEA:UniProtKB-KW | F | calcium-dependent phospholipid binding |
| GO:0001786 | IEA:Ensembl | F | phosphatidylserine binding |
| GO:0016337 | IEA:Ensembl | P | single organismal cell-cell adhesion |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
| Similarity | Belongs to the annexin family. |
| Similarity | Contains 4 annexin repeats. |
| Similarity | Contains annexin repeats. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013796 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109016100 | RefSeq | XP_001103401 | 345 | annexin A9 |
Identical Sequences to LMP013796 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109016100 | GenBank | EHH62652.1 | 345 | hypothetical protein EGM_21042 [Macaca fascicularis] |
Related Sequences to LMP013796 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109016100 | GenBank | EHH15184.1 | 345 | hypothetical protein EGK_01242 [Macaca mulatta] |
| GI:109016100 | RefSeq | XP_003892649.1 | 345 | PREDICTED: annexin A9 [Papio anubis] |
| GI:109016100 | RefSeq | XP_005542011.1 | 345 | PREDICTED: annexin A9 [Macaca fascicularis] |