Gene/Proteome Database (LMPD)

LMPD ID
LMP013782
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
arachidonate 5-lipoxygenase-activating protein
Gene Symbol
Synonyms
FLAP;
Alternate Names
arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; 5-lipoxygenase-activating protein;
Chromosome
17
Map Location
chromosome:17

Proteins

arachidonate 5-lipoxygenase-activating protein
Refseq ID NP_001253418
Protein GI 388490066
UniProt ID F7G851
mRNA ID NM_001266489
Length 161
Protein sequence is identical to GI:109120394 (mRNA isoform)
Refseq ID XP_001100572
Protein GI 109120394
UniProt ID F7G851
mRNA ID XM_001100572
Length 161
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTTISPLLLIP

Gene Information

Entrez Gene ID
Gene Name
arachidonate 5-lipoxygenase-activating protein
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:InterPro C integral component of membrane
GO:0031965 IEA:Ensembl C nuclear membrane
GO:0050544 IEA:Ensembl F arachidonic acid binding
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0071277 IEA:Ensembl P cellular response to calcium ion
GO:0019370 IEA:Ensembl P leukotriene biosynthetic process
GO:0002540 IEA:Ensembl P leukotriene production involved in inflammatory response
GO:0070207 IEA:Ensembl P protein homotrimerization

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
arachidonate 5-lipoxygenase-activating protein
Protein Entry
F7G851_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013782 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109120394 RefSeq XP_001100572 161 arachidonate 5-lipoxygenase-activating protein

Identical Sequences to LMP013782 proteins

Reference Database Accession Length Protein Name
GI:388490066 GenBank EHH28929.1 161 FLAP [Macaca mulatta]
GI:388490066 GenBank EHH58509.1 161 FLAP [Macaca fascicularis]
GI:388490066 GenBank AFE66186.1 161 arachidonate 5-lipoxygenase-activating protein isoform 1 [Macaca mulatta]
GI:388490066 RefSeq XP_005585645.1 161 PREDICTED: arachidonate 5-lipoxygenase-activating protein isoform X2 [Macaca fascicularis]

Related Sequences to LMP013782 proteins

Reference Database Accession Length Protein Name
GI:388490066 DBBJ BAE72962.1 161 hypothetical protein [Macaca fascicularis]