Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001094627 |
| Protein GI | 109112842 |
| UniProt ID | F7EPQ4 |
| mRNA ID | XM_001094627 |
| Length | 662 |
| MGLYRIRLSTGASLHAGSKNQVQLWLVGQHGEAVLGKRLWPARGKETEVKVEVPEYLGPLLFVKLRKRHLLQDDAWFCNWISVQGPGDGDEVRFPCYRWVEGDGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNVAGTKLSDLPVDERFLEDKRVDFEASLAKGLADLAIKDSLNVLTRWKDLDDFKRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPMLLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQYLAAPLVMLKLQPDGKLLPMVIQLQLPSAGSPPPPLFLPTDPPMVWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIAVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGVFDQVVSTGGGGHVELLRRAGGFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIFRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGGQDRGFPVSLQSRDQVCHFVTMCIFTCTGQHSSVHLGQLDWYTWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPIMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIENRNAKLDMPYEYLRPSLVENSVAI | |
| Refseq ID | XP_002800298 |
| Protein GI | 297271648 |
| UniProt ID | F7EPQ4 |
| mRNA ID | XM_001094627 |
| Length | 623 |
| MGLYRIRLSTGASLHAGSKNQVQLWLVGQHGEAVLGKRLWPARGKGPGDGDEVRFPCYRWVEGDGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNVAGTKLSDLPVDERFLEDKRVDFEASLAKGLADLAIKDSLNVLTRWKDLDDFKRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPMLLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQYLAAPLVMLKLQPDGKLLPMVIQLQLPSAGSPPPPLFLPTDPPMVWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIAVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGVFDQVVSTGGGGHVELLRRAGGFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIFRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGGQDRGFPVSLQSRDQVCHFVTMCIFTCTGQHSSVHLGQLDWYTWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPIMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIENRNAKLDMPYEYLRPSLVENSVAI | |
Gene Information
Entrez Gene ID
Gene Name
arachidonate 15-lipoxygenase
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0031234 | IEA:Ensembl | C | extrinsic component of cytoplasmic side of plasma membrane |
| GO:0005811 | IEA:Ensembl | C | lipid particle |
| GO:0004052 | IEA:Ensembl | F | arachidonate 12-lipoxygenase activity |
| GO:0050473 | IEA:Ensembl | F | arachidonate 15-lipoxygenase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0005546 | IEA:Ensembl | F | phosphatidylinositol-4,5-bisphosphate binding |
| GO:0043277 | IEA:Ensembl | P | apoptotic cell clearance |
| GO:0019369 | IEA:Ensembl | P | arachidonic acid metabolic process |
| GO:0030282 | IEA:Ensembl | P | bone mineralization |
| GO:0071277 | IEA:Ensembl | P | cellular response to calcium ion |
| GO:0035963 | IEA:Ensembl | P | cellular response to interleukin-13 |
| GO:2001303 | IEA:Ensembl | P | lipoxin A4 biosynthetic process |
| GO:0019372 | IEA:Ensembl | P | lipoxygenase pathway |
| GO:0002820 | IEA:Ensembl | P | negative regulation of adaptive immune response |
| GO:0006646 | IEA:Ensembl | P | phosphatidylethanolamine biosynthetic process |
| GO:0070374 | IEA:Ensembl | P | positive regulation of ERK1 and ERK2 cascade |
| GO:0030838 | IEA:Ensembl | P | positive regulation of actin filament polymerization |
| GO:0010811 | IEA:Ensembl | P | positive regulation of cell-substrate adhesion |
| GO:1901074 | IEA:Ensembl | P | regulation of engulfment of apoptotic cell |
| GO:0035358 | IEA:Ensembl | P | regulation of peroxisome proliferator activated receptor signaling pathway |
| GO:0034976 | IEA:Ensembl | P | response to endoplasmic reticulum stress |
| GO:0042060 | IEA:Ensembl | P | wound healing |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
arachidonate 15-lipoxygenase
Protein Entry
F7EPQ4_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Cofactor | Note=Iron. ; |
| Similarity | Belongs to the lipoxygenase family. |
| Similarity | Contains PLAT domain. |
| Similarity | Contains lipoxygenase domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013779 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109112842 | RefSeq | XP_001094627 | 662 | arachidonate 15-lipoxygenase |
| 297271648 | RefSeq | XP_002800298 | 623 | arachidonate 15-lipoxygenase |
Identical Sequences to LMP013779 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP013779 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:297271648 | GenBank | EHH24392.1 | 662 | Arachidonate 15-lipoxygenase [Macaca mulatta] |
| GI:297271648 | GenBank | EHH57602.1 | 662 | Arachidonate 15-lipoxygenase [Macaca fascicularis] |
| GI:297271648 | RefSeq | XP_005582628.1 | 662 | PREDICTED: arachidonate 15-lipoxygenase [Macaca fascicularis] |
| GI:297271648 | RefSeq | XP_009187662.1 | 662 | PREDICTED: arachidonate 15-lipoxygenase [Papio anubis] |