Gene/Proteome Database (LMPD)

LMPD ID
LMP013736
Gene ID
574212
Species
Macaca mulatta (Rhesus monkey)
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
ADIPOQ
Synonyms
APM1;
Alternate Names
adiponectin;
Chromosome
2
Map Location
chromosome:2

Proteins

adiponectin precursor
Refseq ID NP_001028043
Protein GI 74136307
UniProt ID Q95JD7
mRNA ID NM_001032871
Length 243
MLLGAVLLLLALPSHGQDTTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGVPGRDGRDGTPGEKGEKGDPGLIGPKGDTGETGVTGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTVPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
sig_peptide: 1..16 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1618 peptide sequence: MLLGAVLLLLALPSHG

Gene Information

Entrez Gene ID
574212
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
ADIPOQ
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0071944 ISS:UniProtKB C cell periphery
GO:0009986 ISS:BHF-UCL C cell surface
GO:0005581 IEA:UniProtKB-KW C collagen trimer
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0005615 ISS:UniProtKB C extracellular space
GO:0048471 ISS:UniProtKB C perinuclear region of cytoplasm
GO:0005179 ISS:UniProtKB F hormone activity
GO:0005102 ISS:UniProtKB F receptor binding
GO:0033211 IEA:InterPro P adiponectin-activated signaling pathway
GO:0050873 ISS:UniProtKB P brown fat cell differentiation
GO:0035690 ISS:UniProtKB P cellular response to drug
GO:0032869 ISS:UniProtKB P cellular response to insulin stimulus
GO:0070994 ISS:UniProtKB P detection of oxidative stress
GO:0006635 ISS:UniProtKB P fatty acid beta-oxidation
GO:0019395 ISS:UniProtKB P fatty acid oxidation
GO:0042593 ISS:UniProtKB P glucose homeostasis
GO:0006006 ISS:UniProtKB P glucose metabolic process
GO:0034383 ISS:UniProtKB P low-density lipoprotein particle clearance
GO:2000279 ISS:UniProtKB P negative regulation of DNA biosynthetic process
GO:0070373 ISS:UniProtKB P negative regulation of ERK1 and ERK2 cascade
GO:0043124 ISS:UniProtKB P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043407 ISS:UniProtKB P negative regulation of MAP kinase activity
GO:0045776 ISS:UniProtKB P negative regulation of blood pressure
GO:0030336 ISS:UniProtKB P negative regulation of cell migration
GO:0045599 ISS:UniProtKB P negative regulation of fat cell differentiation
GO:0045721 ISS:UniProtKB P negative regulation of gluconeogenesis
GO:0030853 ISS:UniProtKB P negative regulation of granulocyte differentiation
GO:0034115 ISS:UniProtKB P negative regulation of heterotypic cell-cell adhesion
GO:0050728 ISS:UniProtKB P negative regulation of inflammatory response
GO:0090317 ISS:UniProtKB P negative regulation of intracellular protein transport
GO:0045715 ISS:UniProtKB P negative regulation of low-density lipoprotein particle receptor biosynthetic process
GO:0010745 ISS:UniProtKB P negative regulation of macrophage derived foam cell differentiation
GO:0045650 ISS:UniProtKB P negative regulation of macrophage differentiation
GO:2000590 ISS:UniProtKB P negative regulation of metanephric mesenchymal cell migration
GO:0050765 ISS:UniProtKB P negative regulation of phagocytosis
GO:0010642 ISS:UniProtKB P negative regulation of platelet-derived growth factor receptor signaling pathway
GO:2000584 ISS:UniProtKB P negative regulation of platelet-derived growth factor receptor-alpha signaling pathway
GO:0031953 ISS:UniProtKB P negative regulation of protein autophosphorylation
GO:1900121 ISS:UniProtKB P negative regulation of receptor binding
GO:0014912 ISS:UniProtKB P negative regulation of smooth muscle cell migration
GO:0048662 ISS:UniProtKB P negative regulation of smooth muscle cell proliferation
GO:0050805 ISS:UniProtKB P negative regulation of synaptic transmission
GO:0045892 ISS:UniProtKB P negative regulation of transcription, DNA-templated
GO:0032720 ISS:UniProtKB P negative regulation of tumor necrosis factor production
GO:0010804 ISS:UniProtKB P negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0043123 ISS:UniProtKB P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:2000481 ISS:UniProtKB P positive regulation of cAMP-dependent protein kinase activity
GO:0032270 ISS:BHF-UCL P positive regulation of cellular protein metabolic process
GO:0010875 ISS:BHF-UCL P positive regulation of cholesterol efflux
GO:0045923 ISS:UniProtKB P positive regulation of fatty acid metabolic process
GO:0046326 ISS:UniProtKB P positive regulation of glucose import
GO:2000467 ISS:UniProtKB P positive regulation of glycogen (starch) synthase activity
GO:0032757 ISS:UniProtKB P positive regulation of interleukin-8 production
GO:2000478 ISS:UniProtKB P positive regulation of metanephric glomerular visceral epithelial cell development
GO:0071639 ISS:UniProtKB P positive regulation of monocyte chemotactic protein-1 production
GO:0033034 ISS:UniProtKB P positive regulation of myeloid cell apoptotic process
GO:0010739 ISS:UniProtKB P positive regulation of protein kinase A signaling
GO:0001934 ISS:UniProtKB P positive regulation of protein phosphorylation
GO:2000534 ISS:UniProtKB P positive regulation of renal albumin absorption
GO:0009967 ISS:UniProtKB P positive regulation of signal transduction
GO:0051260 ISS:UniProtKB P protein homooligomerization
GO:0072659 ISS:UniProtKB P protein localization to plasma membrane
GO:0010906 ISS:UniProtKB P regulation of glucose metabolic process
GO:0009749 ISS:UniProtKB P response to glucose
GO:0034612 ISS:UniProtKB P response to tumor necrosis factor

KEGG Pathway Links

KEGG Pathway ID Description
ko04152 AMPK signaling pathway
mcc04152 AMPK signaling pathway
ko04920 Adipocytokine signaling pathway
mcc04920 Adipocytokine signaling pathway
ko04932 Non-alcoholic fatty liver disease (NAFLD)
mcc04932 Non-alcoholic fatty liver disease (NAFLD)
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway
ko04930 Type II diabetes mellitus
mcc04930 Type II diabetes mellitus

Domain Information

InterPro Annotations

Accession Description
IPR028572 Adiponectin
IPR008160 Collagen triple helix repeat
IPR001073 Complement C1q protein
IPR008983 Tumour necrosis factor-like domain

UniProt Annotations

Entry Information

Gene Name
adiponectin, C1Q and collagen domain containing
Protein Entry
Q95JD7_MACMU
UniProt ID
Q95JD7
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013736 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
74136307 RefSeq NP_001028043 243 adiponectin precursor

Identical Sequences to LMP013736 proteins

Reference Database Accession Length Protein Name
GI:74136307 GenBank AER78341.1 243 Sequence 16 from patent US 8044182
GI:74136307 GenBank EHH16836.1 243 hypothetical protein EGK_12195 [Macaca mulatta]
GI:74136307 GenBank EHH51751.1 243 hypothetical protein EGM_11189 [Macaca fascicularis]
GI:74136307 RefSeq XP_005545517.1 243 PREDICTED: adiponectin isoform X2 [Macaca fascicularis]

Related Sequences to LMP013736 proteins

Reference Database Accession Length Protein Name
GI:74136307 GenBank ACE15889.1 243 Sequence 16 from patent US 7365170
GI:74136307 GenBank ADF22675.1 243 Sequence 4 from patent US 7678886