Gene/Proteome Database (LMPD)
Proteins
| acyl-CoA-binding domain-containing protein 7 | |
|---|---|
| Refseq ID | NP_001245104 |
| Protein GI | 384475917 |
| UniProt ID | F7CHP3 |
| mRNA ID | NM_001258175 |
| Length | 88 |
| Protein sequence is identical to GI:109088296 (mRNA isoform) | |
| Refseq ID | XP_001091346 |
| Protein GI | 109088296 |
| UniProt ID | F7CHP3 |
| mRNA ID | XM_001091346 |
| Length | 88 |
| MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIIGDINIECPGMLDLKGKAKWEAWNLKKGLSTEDAMSAYISKAKELIEKYGI | |
Gene Information
Entrez Gene ID
Gene Name
acyl-CoA binding domain containing 7
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000062 | IEA:InterPro | F | fatty-acyl-CoA binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
acyl-CoA binding domain containing 7
Protein Entry
F7CHP3_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013695 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109088296 | RefSeq | XP_001091346 | 88 | acyl-CoA binding domain containing 7 |
Identical Sequences to LMP013695 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:384475917 | GenBank | AFE78283.1 | 88 | acyl-CoA-binding domain-containing protein 7 [Macaca mulatta] |
| GI:384475917 | RefSeq | XP_003903459.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 [Papio anubis] |
| GI:384475917 | RefSeq | XP_005564750.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 isoform X1 [Macaca fascicularis] |
| GI:384475917 | RefSeq | XP_008000550.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 [Chlorocebus sabaeus] |
Related Sequences to LMP013695 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:384475917 | GenBank | AFE78281.1 | 88 | acyl-CoA-binding domain-containing protein 7 [Macaca mulatta] |
| GI:384475917 | GenBank | AFE78282.1 | 88 | acyl-CoA-binding domain-containing protein 7 [Macaca mulatta] |