Gene/Proteome Database (LMPD)

LMPD ID
LMP013681
Gene ID
696743
Species
Macaca mulatta (Rhesus monkey)
Gene Name
acetyl-CoA acyltransferase 1
Gene Symbol
ACAA1
Alternate Names
acetyl-CoA acyltransferase 1; acetyl-Coenzyme A acyltransferase 1;
Chromosome
2
Map Location
chromosome:2

Proteins

Refseq ID XP_002802920
Protein GI 297286140
UniProt ID F6SR59
mRNA ID XM_001088834
Length 356
MTAVLKDVNLRPEELGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPIALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPSEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Refseq ID XP_001088834
Protein GI 297286138
UniProt ID F6SR59
mRNA ID XM_001088834
Length 454
MWFCACADGCLLTPAVSSATGGWFVELSCAMQRLQVVLGHLTGRPDSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEELGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPIALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPSEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Gene Information

Entrez Gene ID
696743
Gene Name
acetyl-CoA acyltransferase 1
Gene Symbol
ACAA1
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:Ensembl C membrane
GO:0005777 IEA:Ensembl C peroxisome
GO:0016401 IEA:Ensembl F palmitoyl-CoA oxidase activity
GO:0016747 IEA:InterPro F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0008206 IEA:Ensembl P bile acid metabolic process
GO:0006635 IEA:Ensembl P fatty acid beta-oxidation
GO:0000038 IEA:Ensembl P very long-chain fatty acid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko01040 Biosynthesis of unsaturated fatty acids
mcc01040 Biosynthesis of unsaturated fatty acids
ko00071 Fatty acid degradation
mcc00071 Fatty acid degradation
ko01212 Fatty acid metabolism
mcc01212 Fatty acid metabolism
mcc01100 Metabolic pathways
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway
ko04146 Peroxisome
mcc04146 Peroxisome
ko00280 Valine, leucine and isoleucine degradation
mcc00280 Valine, leucine and isoleucine degradation
ko00592 alpha-Linolenic acid metabolism
mcc00592 alpha-Linolenic acid metabolism
M00087 beta-Oxidation
mcc_M00087 beta-Oxidation

Domain Information

InterPro Annotations

Accession Description
IPR002155 Thiolase
IPR020617 Thiolase, C-terminal
IPR020616 Thiolase, N-terminal
IPR020610 Thiolase, active site
IPR020615 Thiolase, acyl-enzyme intermediate active site
IPR020613 Thiolase, conserved site
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
acetyl-CoA acyltransferase 1
Protein Entry
F6SR59_MACMU
UniProt ID
F6SR59
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the thiolase family.

Identical and Related Proteins

Unique RefSeq proteins for LMP013681 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297286138 RefSeq XP_001088834 454 acetyl-CoA acyltransferase 1
297286140 RefSeq XP_002802920 356 acetyl-CoA acyltransferase 1

Identical Sequences to LMP013681 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013681 proteins

Reference Database Accession Length Protein Name
GI:297286140 DBBJ BAE72965.1 424 hypothetical protein [Macaca fascicularis]
GI:297286140 GenBank EHH16508.1 454 hypothetical protein EGK_11796 [Macaca mulatta]
GI:297286140 GenBank AFE77986.1 424 3-ketoacyl-CoA thiolase, peroxisomal isoform a [Macaca mulatta]
GI:297286140 GenBank AFH32148.1 424 3-ketoacyl-CoA thiolase, peroxisomal isoform a [Macaca mulatta]