Gene/Proteome Database (LMPD)
Proteins
| angiopoietin-related protein 3 precursor | |
|---|---|
| Refseq ID | NP_001020236 |
| Protein GI | 68163569 |
| UniProt ID | Q5I0L8 |
| mRNA ID | NM_001025065 |
| Length | 322 |
| MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGKVISLHHSLIC | |
| sig_peptide: 1..16 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1823 peptide sequence: MHTIKLLLFVVPLVIS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009986 | IEA:Ensembl | C | cell surface |
| GO:0005615 | IEA:Ensembl | C | extracellular space |
| GO:0004859 | IEA:Ensembl | F | phospholipase inhibitor activity |
| GO:0048844 | IEA:Ensembl | P | artery morphogenesis |
| GO:0007160 | IEA:Ensembl | P | cell-matrix adhesion |
| GO:0042632 | IEA:Ensembl | P | cholesterol homeostasis |
| GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
| GO:0006631 | IEA:Ensembl | P | fatty acid metabolic process |
| GO:0006071 | IEA:Ensembl | P | glycerol metabolic process |
| GO:0019915 | IEA:Ensembl | P | lipid storage |
| GO:0051005 | IEA:Ensembl | P | negative regulation of lipoprotein lipase activity |
| GO:0010519 | IEA:Ensembl | P | negative regulation of phospholipase activity |
| GO:0009395 | IEA:Ensembl | P | phospholipid catabolic process |
| GO:0055091 | IEA:Ensembl | P | phospholipid homeostasis |
| GO:0045766 | IEA:Ensembl | P | positive regulation of angiogenesis |
| GO:0030335 | IEA:Ensembl | P | positive regulation of cell migration |
| GO:0050996 | IEA:Ensembl | P | positive regulation of lipid catabolic process |
| GO:0009725 | IEP:RGD | P | response to hormone |
| GO:0007165 | IEA:Ensembl | P | signal transduction |
| GO:0070328 | IEA:Ensembl | P | triglyceride homeostasis |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013610 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 68163569 | RefSeq | NP_001020236 | 322 | angiopoietin-related protein 3 precursor |
Identical Sequences to LMP013610 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:68163569 | GenBank | AAH88192.1 | 322 | Angiopoietin-like 3 [Rattus norvegicus] |
Related Sequences to LMP013610 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:68163569 | DBBJ | BAE28956.1 | 455 | unnamed protein product [Mus musculus] |
| GI:68163569 | GenBank | AAH88192.1 | 322 | Angiopoietin-like 3 [Rattus norvegicus] |
| GI:68163569 | GenBank | EDL97807.1 | 455 | angiopoietin-like 3, isoform CRA_b [Rattus norvegicus] |
| GI:68163569 | RefSeq | XP_006238502.1 | 455 | PREDICTED: angiopoietin-related protein 3 isoform X1 [Rattus norvegicus] |