Gene/Proteome Database (LMPD)
Proteins
| stAR-related lipid transfer protein 5 | |
|---|---|
| Refseq ID | NP_001178940 |
| Protein GI | 300795781 |
| UniProt ID | D3ZN38 |
| mRNA ID | NM_001192011 |
| Length | 213 |
| MDLSWATQESEAVAEKVLRYRRDASGWKKCREGNGVSISWRPSEEFPGNLYRGEGILCGTPEEVWDCVKPVAGGLREKWDDNVNSFEIVQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKKYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPNKTHLVTFFQTDLNGYLPQSVVDSFFPRSMAEFYPNLQKAVRKFHH | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 5
Protein Entry
D3ZN38_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013607 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 300795781 | RefSeq | NP_001178940 | 213 | stAR-related lipid transfer protein 5 |
Identical Sequences to LMP013607 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:300795781 | GenBank | EDM08749.1 | 213 | similar to StAR-related protein 1-4E (predicted), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013607 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:300795781 | DBBJ | BAC37819.1 | 213 | unnamed protein product [Mus musculus] |
| GI:300795781 | DBBJ | BAC39551.1 | 213 | unnamed protein product [Mus musculus] |
| GI:300795781 | GenBank | AAG41056.1 | 219 | StAR-related protein 1-4E, partial [Mus musculus] |
| GI:300795781 | GenBank | EDM08749.1 | 213 | similar to StAR-related protein 1-4E (predicted), isoform CRA_a [Rattus norvegicus] |