Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein F precursor | |
|---|---|
| Refseq ID | NP_001019522 |
| Protein GI | 66730497 |
| UniProt ID | Q5M889 |
| mRNA ID | NM_001024351 |
| Length | 308 |
| MGAQLLTCTVSDSIRHQFSCFATSCCVLWVPKGVSTMLPPSQLGSQPPTSDPLSCQALLPRSLPGFTHMPPLSKFLVGLALRNALEEAGCWADVWALQLQLYRFGGVEATQALIRHLQELQKGGRADWKVSVNALSSALQLLAWEQAGPKRVKRSLSNMGCENEQEQRVHNVVELLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSGGPTGAVITAALKPALKAGVQRLIRYYHDEEGVTTSQPETRKDAPTYRDDVEETTMSNLVSEVESTTSNWGRPLLKNYVFLAYKR | |
| mat_peptide: 155..308 product: Apolipoprotein F experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5M889.1) calculated_mol_wt: 17075 peptide sequence: SLSNMGCENEQEQRVHNVVELLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSGGPTGAVITAALKPALKAGVQRLIRYYHDEEGVTTSQPETRKDAPTYRDDVEETTMSNLVSEVESTTSNWGRPLLKNYVFLAYKR | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0034364 | IEA:UniProtKB-KW | C | high-density lipoprotein particle |
| GO:0034362 | IEA:UniProtKB-KW | C | low-density lipoprotein particle |
| GO:0033344 | IEA:Ensembl | P | cholesterol efflux |
| GO:0008203 | IEA:UniProtKB-KW | P | cholesterol metabolic process |
| GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR026114 | Apolipoprotein F |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Minor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII (By similarity) |
| Subcellular Location | Secreted . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013597 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 66730497 | RefSeq | NP_001019522 | 308 | apolipoprotein F precursor |
Identical Sequences to LMP013597 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66730497 | GenBank | AAH88170.1 | 308 | Apolipoprotein F [Rattus norvegicus] |
| GI:66730497 | GenBank | EDL84878.1 | 308 | similar to apolipoprotein F [Rattus norvegicus] |
| GI:66730497 | SwissProt | Q5M889.1 | 308 | RecName: Full=Apolipoprotein F; Short=Apo-F; AltName: Full=Liver regeneration-related protein LRRG151; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013597 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66730497 | GenBank | AAP92630.1 | 240 | Ba1-666 [Rattus norvegicus] |
| GI:66730497 | GenBank | AAH88170.1 | 308 | Apolipoprotein F [Rattus norvegicus] |
| GI:66730497 | GenBank | EDL84878.1 | 308 | similar to apolipoprotein F [Rattus norvegicus] |
| GI:66730497 | SwissProt | Q5M889.1 | 308 | RecName: Full=Apolipoprotein F; Short=Apo-F; AltName: Full=Liver regeneration-related protein LRRG151; Flags: Precursor [Rattus norvegicus] |