LIPID MAPS

LMPD ID

LMP013575

Gene ID

498728

Species

Rattus norvegicus (Rat)

Gene Name

ELOVL fatty acid elongase 2

Gene Symbol

Elovl2

Alternate Names

elongation of very long chain fatty acids protein 2; ELOVL FA elongase 2; 3-keto acyl-CoA synthase Elovl2; very-long-chain 3-oxoacyl-CoA synthase 2; elongation of very long chain fatty acids-like 2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2;

Chromosome

17

Map Location

17p12

EC Number

2.3.1.199

elongation of very long chain fatty acids protein 2
Refseq ID	NP_001102588
Protein GI	157819785
UniProt ID	D4A612
mRNA ID	NM_001109118
Length	279
MFGPRDSRVRGWFLLDSYLPTFTLTIVYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLVELVLSSWEGGYNLQCQNLDSAGEGDIRVAKVLWWYYFSKLVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHRYLWWKKYLTQAQLVQFVLTITHTLSAVVKPCGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPMKKEMPEGAAGKEVKNGFPKAHSIAANGVTDKKVQ

Entrez Gene ID

498728

Gene Name

ELOVL fatty acid elongase 2

Gene Symbol

Elovl2

Species

Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005783	IEA:UniProtKB-KW	C	endoplasmic reticulum
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0009922	IEA:Ensembl	F	fatty acid elongase activity
GO:0034626	IEA:Ensembl	P	fatty acid elongation, polyunsaturated fatty acid
GO:0006636	IEA:UniProtKB-UniPathway	P	unsaturated fatty acid biosynthetic process
GO:0042761	IEA:Ensembl	P	very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID	Description
ko01040	Biosynthesis of unsaturated fatty acids
rno01040	Biosynthesis of unsaturated fatty acids
M00415	Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062	Fatty acid elongation
rno00062	Fatty acid elongation
ko01212	Fatty acid metabolism
rno01212	Fatty acid metabolism

REACTOME Pathway Links

REACTOME Pathway ID	Description
5953463	Fatty Acyl-CoA Biosynthesis
5953288	Fatty acid, triacylglycerol, and ketone body metabolism
5954541	Linoleic acid (LA) metabolism
5953250	Metabolism
5953289	Metabolism of lipids and lipoproteins
5953471	Synthesis of very long-chain fatty acyl-CoAs
5953464	Triglyceride Biosynthesis
5954542	alpha-linolenic (omega3) and linoleic (omega6) acid metabolism
5954543	alpha-linolenic acid (ALA) metabolism

InterPro Annotations

Accession	Description
IPR002076	ELO family

Entry Information

Gene Name

ELOVL fatty acid elongase 2

Protein Entry

ELOV2_RAT

UniProt ID

D4A612

Species

Rat

Comments

Comment Type	Description
Catalytic Activity	A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2)
Domain	The di-lysine motif may confer endoplasmic reticulum localization
Function	Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (n-6 and n-3 C18-, C20- and C22-PUFA)
Pathway	Lipid metabolism; polyunsaturated fatty acid biosynthesis
Similarity	Belongs to the ELO family
Subcellular Location	Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein .

Unique RefSeq proteins for LMP013575 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
157819785	RefSeq	NP_001102588	279	elongation of very long chain fatty acids protein 2

Identical Sequences to LMP013575 proteins

Reference	Database	Accession	Length	Protein Name
GI:157819785	GenBank	EDL98219.1	279	elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157819785	GenBank	EDL98220.1	279	elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157819785	RefSeq	XP_006253841.1	279	PREDICTED: elongation of very long chain fatty acids protein 2 isoform X1 [Rattus norvegicus]
GI:157819785	SwissProt	D4A612.1	279	RecName: Full=Elongation of very long chain fatty acids protein 2; AltName: Full=3-keto acyl-CoA synthase Elovl2; AltName: Full=ELOVL fatty acid elongase 2; Short=ELOVL FA elongase 2; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 2 [Rattus norvegicus]

Related Sequences to LMP013575 proteins

Reference	Database	Accession	Length	Protein Name
GI:157819785	GenBank	EDL98219.1	279	elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157819785	GenBank	EDL98220.1	279	elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157819785	RefSeq	XP_006253841.1	279	PREDICTED: elongation of very long chain fatty acids protein 2 isoform X1 [Rattus norvegicus]
GI:157819785	SwissProt	D4A612.1	279	RecName: Full=Elongation of very long chain fatty acids protein 2; AltName: Full=3-keto acyl-CoA synthase Elovl2; AltName: Full=ELOVL fatty acid elongase 2; Short=ELOVL FA elongase 2; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 2 [Rattus norvegicus]