Gene/Proteome Database (LMPD)
Proteins
| PI-PLC X domain-containing protein 2 | |
|---|---|
| Refseq ID | NP_001127953 |
| Protein GI | 197333713 |
| UniProt ID | D4A4P6 |
| mRNA ID | NM_001134481 |
| Length | 340 |
| MLAFRKARRKLRMGTICSPNPSGTKTASEVCNADWMASLPPHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAVKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDTDQEIYFIHGLFGIKVWDGLMEIDAFLTQHPQEIIFLDFNHFYAMDEAHHKCLVLRIQEAFGNKLCPACSVESMTLRTLWEKKYQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVQKLILFLETTLSERAPRGAFHVSQAILTPRVKTIARGLVGGLKNTLVHRNLPAILDWVKTQKPGAMGVNIITSDFVDLIDFATTVIELNDLLEDRALTKC | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol-specific phospholipase C, X domain containing 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008081 | IEA:InterPro | F | phosphoric diester hydrolase activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol-specific phospholipase C, X domain containing 2
Protein Entry
D4A4P6_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013510 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 197333713 | RefSeq | NP_001127953 | 340 | PI-PLC X domain-containing protein 2 |
Identical Sequences to LMP013510 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP013510 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:197333713 | GenBank | AAI51060.1 | 340 | Plcxd2 protein [Mus musculus] |
| GI:197333713 | GenBank | AAI51064.1 | 340 | Plcxd2 protein [Mus musculus] |
| GI:197333713 | RefSeq | NP_001127952.1 | 340 | phosphatidylinositol-specific phospholipase C, X domain containing 2 [Mus musculus] |
| GI:197333713 | RefSeq | XP_007619519.1 | 340 | PREDICTED: PI-PLC X domain-containing protein 2 isoform X1 [Cricetulus griseus] |