Gene/Proteome Database (LMPD)
LMPD ID
LMP013508
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
tafazzin
Gene Symbol
Alternate Names
tafazzin; Barth syndrome); endocardial fibroelastosis 2; cardiomyopathy, dilated 3A (X-linked); tafazzin (cardiomyopathy, dilated 3A (X-linked); tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome);
Chromosome
X
Map Location
chromosome:X
Summary
human homolog may play a role in cardiolipin metabolism [RGD, Feb 2006]
Orthologs
Proteins
| tafazzin | |
|---|---|
| Refseq ID | NP_001020919 |
| Protein GI | 71043828 |
| UniProt ID | Q4KLG6 |
| mRNA ID | NM_001025748 |
| Length | 262 |
| MPLHVKWPFPAVPRLTWTLASSVVMGLVGTYSCFWTKYMNHLTVYNKEVLYELIENRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSTLPVLERLRAENKSAVEMRKALTDFIQEEFQRLKMQAEQLHNHFQPGR | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0047184 | IEA:Ensembl | F | 1-acylglycerophosphocholine O-acyltransferase activity |
| GO:0060048 | IEA:Ensembl | P | cardiac muscle contraction |
| GO:0048738 | IEA:Ensembl | P | cardiac muscle tissue development |
| GO:0032049 | IEA:Ensembl | P | cardiolipin biosynthetic process |
| GO:0042407 | IEA:Ensembl | P | cristae formation |
| GO:0030097 | IEA:Ensembl | P | hemopoiesis |
| GO:0042775 | IEA:Ensembl | P | mitochondrial ATP synthesis coupled electron transport |
| GO:0032981 | IEA:Ensembl | P | mitochondrial respiratory chain complex I assembly |
| GO:0007519 | IEA:Ensembl | P | skeletal muscle tissue development |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013508 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 71043828 | RefSeq | NP_001020919 | 262 | tafazzin |
Identical Sequences to LMP013508 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71043828 | GenBank | AAH99221.1 | 262 | Tafazzin [Rattus norvegicus] |
| GI:71043828 | GenBank | EDL84983.1 | 262 | tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome) (mapped), isoform CRA_c [Rattus norvegicus] |
| GI:71043828 | RefSeq | XP_006229661.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |
| GI:71043828 | RefSeq | XP_006229662.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013508 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71043828 | GenBank | AAH99221.1 | 262 | Tafazzin [Rattus norvegicus] |
| GI:71043828 | GenBank | EDL84983.1 | 262 | tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome) (mapped), isoform CRA_c [Rattus norvegicus] |
| GI:71043828 | RefSeq | XP_006229661.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |
| GI:71043828 | RefSeq | XP_006229662.1 | 262 | PREDICTED: tafazzin isoform X1 [Rattus norvegicus] |