Gene/Proteome Database (LMPD)

LMPD ID
LMP013491
Gene ID
362809
Species
Rattus norvegicus (Rat)
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Ptges3
Synonyms
RGD1561913;
Alternate Names
prostaglandin E synthase 3; cPGES; hsp90 co-chaperone; prostaglandin-E synthase 3; telomerase-binding protein p23; progesterone receptor complex p23; cytosolic prostaglandin E2 synthase; ptges3 {ECO:0000250|UniProtKB:Q15185};
Chromosome
7
Map Location
7q11
EC Number
5.3.99.3

Proteins

prostaglandin E synthase 3
Refseq ID NP_001124461
Protein GI 195976800
UniProt ID P83868
mRNA ID NM_001130989
Length 160
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Gene Information

Entrez Gene ID
362809
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Ptges3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005884 IDA:RGD C actin filament
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IDA:RGD C neuronal cell body
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0043234 IDA:RGD C protein complex
GO:0051879 IDA:RGD F Hsp90 protein binding
GO:0019899 IPI:RGD F enzyme binding
GO:0002039 IDA:RGD F p53 binding
GO:0050220 ISS:UniProtKB F prostaglandin-E synthase activity
GO:0051082 ISS:UniProtKB F unfolded protein binding
GO:0060548 IMP:RGD P negative regulation of cell death
GO:0010628 IMP:RGD P positive regulation of gene expression
GO:0001516 ISS:UniProtKB P prostaglandin biosynthetic process
GO:0006693 IMP:RGD P prostaglandin metabolic process
GO:0019233 IMP:RGD P sensory perception of pain

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR007052 CS domain
IPR008978 HSP20-like chaperone

UniProt Annotations

Entry Information

Gene Name
prostaglandin E synthase 3 (cytosolic)
Protein Entry
TEBP_RAT
UniProt ID
P83868
Species
Rat

Comments

Comment Type Description
Catalytic Activity (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15- dihydroxy-9-oxoprosta-5,13-dienoate
Function Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) (PubMed:10922363). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway (By similarity). {ECO:0000250|UniProtKB:Q15185, ECO:0000269|PubMed:10922363}.
Induction In brain, by LPS
Pathway Lipid metabolism; prostaglandin biosynthesis
Sequence Caution Sequence=CK475788; Type=Frameshift; Positions=156; Evidence= ;
Similarity Belongs to the p23/wos2 family
Similarity Contains 1 CS domain. {ECO:0000255|PROSITE- ProRule:PRU00547}.
Subcellular Location Cytoplasm .
Subunit Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is required for correct assembly and stabilization of the telomerase holoenzyme complex. Interacts (via PXLE motif) with EGLN1/PHD2, recruiting EGLN1/PHD2 to the HSP90 pathway to facilitate HIF alpha proteins hydroxylation
Tissue Specificity Widely expressed with highest levels in testis

Identical and Related Proteins

Unique RefSeq proteins for LMP013491 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
195976800 RefSeq NP_001124461 160 prostaglandin E synthase 3

Identical Sequences to LMP013491 proteins

Reference Database Accession Length Protein Name
GI:195976800 RefSeq XP_005079789.1 160 PREDICTED: prostaglandin E synthase 3 isoform X1 [Mesocricetus auratus]
GI:195976800 RefSeq XP_005371265.1 160 PREDICTED: prostaglandin E synthase 3 [Microtus ochrogaster]
GI:195976800 RefSeq XP_006544122.1 160 PREDICTED: prostaglandin E synthase 3-like [Mus musculus]
GI:195976800 RefSeq XP_008826610.1 160 PREDICTED: prostaglandin E synthase 3 [Nannospalax galili]

Related Sequences to LMP013491 proteins

Reference Database Accession Length Protein Name
GI:195976800 DBBJ BAC36062.1 160 unnamed protein product [Mus musculus]
GI:195976800 DBBJ BAC36099.1 160 unnamed protein product [Mus musculus]
GI:195976800 DBBJ BAC36854.1 160 unnamed protein product [Mus musculus]
GI:195976800 GenBank AAI66579.1 160 Ptges3 protein [Rattus norvegicus]