Gene/Proteome Database (LMPD)
LMPD ID
LMP013472
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
microtubule-associated protein 1 light chain 3 alpha
Gene Symbol
Alternate Names
microtubule-associated proteins 1A/1B light chain 3A; MAP1A/MAP1B LC3 A; MAP1A/1B light chain 3 A; MAP1A/MAP1B light chain 3 A; autophagy-related protein LC3 A; MAP1 light chain 3-like protein 1; autophagy-related ubiquitin-like modifier LC3 A;
Chromosome
3
Map Location
3q42
Summary
light chain subunit of MAP1A and MAP1B microtubule-associated proteins; mediates interactions between microtubules and the cytoskeleton [RGD, Feb 2006]
Orthologs
Proteins
| microtubule-associated proteins 1A/1B light chain 3A | |
|---|---|
| Refseq ID | NP_955794 |
| Protein GI | 41054834 |
| UniProt ID | Q6XVN8 |
| mRNA ID | NM_199500 |
| Length | 121 |
| MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF | |
| mat_peptide: 1..120 product: Microtubule-associated proteins 1A/1B light chain 3A experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q6XVN8.1) calculated_mol_wt: 14125 peptide sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG | |
Gene Information
Entrez Gene ID
Gene Name
microtubule-associated protein 1 light chain 3 alpha
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005776 | IDA:UniProtKB | C | autophagic vacuole |
| GO:0000421 | IDA:RGD | C | autophagic vacuole membrane |
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
| GO:0005829 | IDA:RGD | C | cytosol |
| GO:0005770 | IDA:RGD | C | late endosome |
| GO:0005874 | IEA:UniProtKB-KW | C | microtubule |
| GO:0031090 | IDA:UniProtKB | C | organelle membrane |
| GO:0008429 | IEA:Ensembl | F | phosphatidylethanolamine binding |
| GO:0000045 | IDA:UniProtKB | P | autophagic vacuole assembly |
| GO:0006914 | IDA:RGD | P | autophagy |
| GO:0000422 | IEA:Ensembl | P | mitochondrion degradation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
microtubule-associated protein 1 light chain 3 alpha
Protein Entry
MLP3A_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Function | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity) |
| Ptm | Phosphorylation at Ser-12 by PKA inhibits conjugation to phosphatidylethanolamine (PE). Interaction with MAPK15 reduces the inhibitory phosphorylation and increases autophagy activity (By similarity) |
| Ptm | The precursor molecule is cleaved by ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II |
| Similarity | Belongs to the ATG8 family |
| Subcellular Location | Cytoplasm, cytoskeleton. Endomembrane system; Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane {ECO:0000250}; Lipid-anchor . Note=LC3-II binds to the autophagic membranes |
| Subunit | 3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins (By similarity). Interacts with TP53INP2 (By similarity). Interacts with TP53INP1 and SQSTM1. Directly interacts with SQSTM1; this interaction leads to MAP1LC3A recruitment to inclusion bodies containing polyubiquitinated protein aggregates and to inclusion body degradation by autophagy (By similarity). Interacts with ATG13 and ULK1 (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP013472 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41054834 | RefSeq | NP_955794 | 121 | microtubule-associated proteins 1A/1B light chain 3A |
Identical Sequences to LMP013472 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054834 | RefSeq | XP_009231795.1 | 121 | PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Pongo abelii] |
| GI:41054834 | RefSeq | XP_010384802.1 | 121 | PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Rhinopithecus roxellana] |
| GI:41054834 | RefSeq | XP_010384803.1 | 121 | PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Rhinopithecus roxellana] |
| GI:41054834 | RefSeq | XP_010340986.1 | 121 | PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Saimiri boliviensis boliviensis] |
Related Sequences to LMP013472 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054834 | DBBJ | BAI46339.1 | 121 | microtubule-associated protein 1 light chain 3 alpha, partial [synthetic construct] |
| GI:41054834 | GenBank | AAK35151.1 | 121 | MAP1 light chain 3-like protein 1 [Homo sapiens] |
| GI:41054834 | GenBank | AAH10596.1 | 121 | Microtubule-associated protein 1 light chain 3 alpha [Mus musculus] |
| GI:41054834 | RefSeq | NP_115903.1 | 121 | microtubule-associated proteins 1A/1B light chain 3A isoform a [Homo sapiens] |