Gene/Proteome Database (LMPD)

LMPD ID
LMP013472
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
microtubule-associated protein 1 light chain 3 alpha
Gene Symbol
Alternate Names
microtubule-associated proteins 1A/1B light chain 3A; MAP1A/MAP1B LC3 A; MAP1A/1B light chain 3 A; MAP1A/MAP1B light chain 3 A; autophagy-related protein LC3 A; MAP1 light chain 3-like protein 1; autophagy-related ubiquitin-like modifier LC3 A;
Chromosome
3
Map Location
3q42
Summary
light chain subunit of MAP1A and MAP1B microtubule-associated proteins; mediates interactions between microtubules and the cytoskeleton [RGD, Feb 2006]
Orthologs

Proteins

microtubule-associated proteins 1A/1B light chain 3A
Refseq ID NP_955794
Protein GI 41054834
UniProt ID Q6XVN8
mRNA ID NM_199500
Length 121
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
mat_peptide: 1..120 product: Microtubule-associated proteins 1A/1B light chain 3A experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q6XVN8.1) calculated_mol_wt: 14125 peptide sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG

Gene Information

Entrez Gene ID
Gene Name
microtubule-associated protein 1 light chain 3 alpha
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005776 IDA:UniProtKB C autophagic vacuole
GO:0000421 IDA:RGD C autophagic vacuole membrane
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005829 IDA:RGD C cytosol
GO:0005770 IDA:RGD C late endosome
GO:0005874 IEA:UniProtKB-KW C microtubule
GO:0031090 IDA:UniProtKB C organelle membrane
GO:0008429 IEA:Ensembl F phosphatidylethanolamine binding
GO:0000045 IDA:UniProtKB P autophagic vacuole assembly
GO:0006914 IDA:RGD P autophagy
GO:0000422 IEA:Ensembl P mitochondrion degradation

Domain Information

InterPro Annotations

Accession Description
IPR004241 Autophagy protein Atg8 ubiquitin like
IPR029071 Ubiquitin-related domain

UniProt Annotations

Entry Information

Gene Name
microtubule-associated protein 1 light chain 3 alpha
Protein Entry
MLP3A_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity)
Ptm Phosphorylation at Ser-12 by PKA inhibits conjugation to phosphatidylethanolamine (PE). Interaction with MAPK15 reduces the inhibitory phosphorylation and increases autophagy activity (By similarity)
Ptm The precursor molecule is cleaved by ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II
Similarity Belongs to the ATG8 family
Subcellular Location Cytoplasm, cytoskeleton. Endomembrane system; Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane {ECO:0000250}; Lipid-anchor . Note=LC3-II binds to the autophagic membranes
Subunit 3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins (By similarity). Interacts with TP53INP2 (By similarity). Interacts with TP53INP1 and SQSTM1. Directly interacts with SQSTM1; this interaction leads to MAP1LC3A recruitment to inclusion bodies containing polyubiquitinated protein aggregates and to inclusion body degradation by autophagy (By similarity). Interacts with ATG13 and ULK1 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP013472 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41054834 RefSeq NP_955794 121 microtubule-associated proteins 1A/1B light chain 3A

Identical Sequences to LMP013472 proteins

Reference Database Accession Length Protein Name
GI:41054834 RefSeq XP_009231795.1 121 PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Pongo abelii]
GI:41054834 RefSeq XP_010384802.1 121 PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Rhinopithecus roxellana]
GI:41054834 RefSeq XP_010384803.1 121 PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Rhinopithecus roxellana]
GI:41054834 RefSeq XP_010340986.1 121 PREDICTED: microtubule-associated proteins 1A/1B light chain 3A [Saimiri boliviensis boliviensis]

Related Sequences to LMP013472 proteins

Reference Database Accession Length Protein Name
GI:41054834 DBBJ BAI46339.1 121 microtubule-associated protein 1 light chain 3 alpha, partial [synthetic construct]
GI:41054834 GenBank AAK35151.1 121 MAP1 light chain 3-like protein 1 [Homo sapiens]
GI:41054834 GenBank AAH10596.1 121 Microtubule-associated protein 1 light chain 3 alpha [Mus musculus]
GI:41054834 RefSeq NP_115903.1 121 microtubule-associated proteins 1A/1B light chain 3A isoform a [Homo sapiens]