Gene/Proteome Database (LMPD)
Proteins
| quinone oxidoreductase | |
|---|---|
| Refseq ID | NP_001012183 |
| Protein GI | 58865938 |
| UniProt ID | Q6AYT0 |
| mRNA ID | NM_001012183 |
| Length | 329 |
| MATGQKLMRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGVSAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKTSAGDKGVDVIIEMLANKNLSNDLKLLSCGGRVIVVGCRGSIEINPRDTMAKETSIIGVSLFSSTKEEFQQFAGILQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHSSGKMGKMILLL | |
Gene Information
Entrez Gene ID
Gene Name
crystallin, zeta (quinone reductase)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
| GO:0005829 | ISS:UniProtKB | C | cytosol |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0070402 | ISS:UniProtKB | F | NADPH binding |
| GO:0003960 | ISS:UniProtKB | F | NADPH:quinone reductase activity |
| GO:0003730 | ISS:UniProtKB | F | mRNA 3'-UTR binding |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0051289 | IEA:Ensembl | P | protein homotetramerization |
| GO:0042178 | ISS:UniProtKB | P | xenobiotic catabolic process |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | NADPH + 2 quinone = NADP(+) + 2 semiquinone. |
| Function | Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species and enhances their stability. NADPH binding interferes with mRNA binding (By similarity) |
| Similarity | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily |
| Subcellular Location | Cytoplasm . |
| Subunit | Homotetramer |
Identical and Related Proteins
Unique RefSeq proteins for LMP013467 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 58865938 | RefSeq | NP_001012183 | 329 | quinone oxidoreductase |
Identical Sequences to LMP013467 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:58865938 | GenBank | EDL82539.1 | 329 | rCG28670, isoform CRA_a [Rattus norvegicus] |
| GI:58865938 | GenBank | EDL82540.1 | 329 | rCG28670, isoform CRA_a [Rattus norvegicus] |
| GI:58865938 | RefSeq | XP_006233582.1 | 329 | PREDICTED: quinone oxidoreductase isoform X1 [Rattus norvegicus] |
| GI:58865938 | SwissProt | Q6AYT0.1 | 329 | RecName: Full=Quinone oxidoreductase; AltName: Full=NADPH:quinone reductase; AltName: Full=Zeta-crystallin [Rattus norvegicus] |
Related Sequences to LMP013467 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:58865938 | GenBank | AAH78927.1 | 329 | Crystallin, zeta [Rattus norvegicus] |
| GI:58865938 | GenBank | EDL82539.1 | 329 | rCG28670, isoform CRA_a [Rattus norvegicus] |
| GI:58865938 | GenBank | EDL82540.1 | 329 | rCG28670, isoform CRA_a [Rattus norvegicus] |
| GI:58865938 | RefSeq | XP_006233582.1 | 329 | PREDICTED: quinone oxidoreductase isoform X1 [Rattus norvegicus] |