Gene/Proteome Database (LMPD)

LMPD ID
LMP013466
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
dual adaptor of phosphotyrosine and 3-phosphoinositides
Gene Symbol
Alternate Names
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; dual adaptor for phosphotyrosine and 3-phosphoinositides 1;
Chromosome
2
Map Location
2q44

Proteins

dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
Refseq ID NP_001102038
Protein GI 157819323
UniProt ID D4ACC1
mRNA ID NM_001108568
Length 279
MGRAELLGGNMSTQDPSELWGRADGGSDLFQDLGWYHSNLTRHAAEALLLSNGRDGSYLLRDSNEQTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEYSSLKDFVKHFANQPLIGSETGTLIVLKHPYPRQVEEPSIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLQRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQDRVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSKIRKQLDQDDTIRSRSFIFK

Gene Information

Entrez Gene ID
Gene Name
dual adaptor of phosphotyrosine and 3-phosphoinositides
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005942 IEA:InterPro C phosphatidylinositol 3-kinase complex
GO:0005886 IEA:Ensembl C plasma membrane
GO:0035014 IEA:InterPro F phosphatidylinositol 3-kinase regulator activity
GO:0005547 IEA:Ensembl F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0043325 IEA:Ensembl F phosphatidylinositol-3,4-bisphosphate binding

KEGG Pathway Links

KEGG Pathway ID Description
ko04662 B cell receptor signaling pathway
rno04662 B cell receptor signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953415 Adaptive Immune System
5953413 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
5953410 Immune System
5953414 Signaling by the B Cell Receptor (BCR)

Domain Information

InterPro Annotations

Accession Description
IPR001720 PI3 kinase, P85 regulatory subunit
IPR001849 Pleckstrin homology domain
IPR011993 Pleckstrin homology-like domain
IPR000980 SH2 domain

UniProt Annotations

Entry Information

Gene Name
dual adaptor of phosphotyrosine and 3-phosphoinositides
Protein Entry
D4ACC1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Similarity Contains 1 PH domain
Similarity Contains PH domain

Identical and Related Proteins

Unique RefSeq proteins for LMP013466 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157819323 RefSeq NP_001102038 279 dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Identical Sequences to LMP013466 proteins

Reference Database Accession Length Protein Name
GI:157819323 GenBank EDL82303.1 279 dual adaptor for phosphotyrosine and 3-phosphoinositides 1 (predicted) [Rattus norvegicus]

Related Sequences to LMP013466 proteins

Reference Database Accession Length Protein Name
GI:157819323 GenBank AAF14579.1 280 B lymphocyte adapter protein BAM32 [Mus musculus]
GI:157819323 GenBank ABK42134.1 280 Bam32 [synthetic construct]
GI:157819323 GenBank EDL82303.1 279 dual adaptor for phosphotyrosine and 3-phosphoinositides 1 (predicted) [Rattus norvegicus]
GI:157819323 SwissProt Q9QXT1.1 280 RecName: Full=Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; Short=mDAPP1; AltName: Full=B lymphocyte adapter protein Bam32; AltName: Full=B-cell adapter molecule of 32 kDa [Mus musculus]