Gene/Proteome Database (LMPD)

LMPD ID
LMP013444
Gene ID
361631
Species
Rattus norvegicus (Rat)
Gene Name
cytochrome P450, family 2, subfamily r, polypeptide 1
Gene Symbol
Cyp2r1
Alternate Names
vitamin D 25-hydroxylase;
Chromosome
1
Map Location
1q34

Proteins

vitamin D 25-hydroxylase
Refseq ID NP_001101969
Protein GI 157817450
UniProt ID F7FAJ1
mRNA ID NM_001108499
Length 205
MKMTKMGVGELIIAGTETTTNVLRWAVLFMALYPNIQGQVHKEIDLIMGHDRRPSWEDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFLDSSGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHELVPNLKPRLGMTLQPQAYLICAERR

Gene Information

Entrez Gene ID
361631
Gene Name
cytochrome P450, family 2, subfamily r, polypeptide 1
Gene Symbol
Cyp2r1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IEA:UniProtKB-KW F monooxygenase activity
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0010164 IEP:RGD P response to cesium ion
GO:0010212 IEP:RGD P response to ionizing radiation
GO:0010038 IEP:RGD P response to metal ion

KEGG Pathway Links

KEGG Pathway ID Description
M00103 Cholecalciferol biosynthesis
rno01100 Metabolic pathways
ko00100 Steroid biosynthesis
rno00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953258 Biological oxidations
5953485 Cytochrome P450 - arranged by substrate type
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953937 Metabolism of steroid hormones and vitamin D
5953326 Phase 1 - Functionalization of compounds
5954056 Vitamin D (calciferol) metabolism
5954061 Vitamins

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 2, subfamily r, polypeptide 1
Protein Entry
F7FAJ1_RAT
UniProt ID
F7FAJ1
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013444 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157817450 RefSeq NP_001101969 205 vitamin D 25-hydroxylase

Identical Sequences to LMP013444 proteins

Reference Database Accession Length Protein Name
GI:157817450 GenBank EDM17771.1 205 cytochrome P450, family 2, subfamily r, polypeptide 1 (predicted), isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP013444 proteins

Reference Database Accession Length Protein Name
GI:157817450 DBBJ BAC34265.1 205 unnamed protein product [Mus musculus]
GI:157817450 GenBank EDL17073.1 205 cytochrome P450, family 2, subfamily r, polypeptide 1, isoform CRA_b [Mus musculus]
GI:157817450 GenBank EDM17771.1 205 cytochrome P450, family 2, subfamily r, polypeptide 1 (predicted), isoform CRA_b [Rattus norvegicus]
GI:157817450 RefSeq XP_006507903.1 320 PREDICTED: vitamin D 25-hydroxylase isoform X3 [Mus musculus]