Gene/Proteome Database (LMPD)
LMPD ID
LMP013441
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
lysophosphatidylcholine acyltransferase 1
Gene Symbol
Synonyms
Aytl2; RGD1311599;
Alternate Names
lysophosphatidylcholine acyltransferase 1; LPCAT-1; lysoPAFAT; LPC acyltransferase 1; acyltransferase-like 2; lysoPC acyltransferase 1; lyso-PAF acetyltransferase; acetyl-CoA:lyso-PAF acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acetyl-CoA:lyso-platelet-activating factor acetyltransferase;
Chromosome
1
Map Location
1p11
EC Number
2.3.1.23
Proteins
| lysophosphatidylcholine acyltransferase 1 | |
|---|---|
| Refseq ID | NP_001094205 |
| Protein GI | 213688411 |
| UniProt ID | Q1HAQ0 |
| mRNA ID | NM_001100735 |
| Length | 534 |
| MRLRGRGPRAAPSSSSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLFAAFMMLLAWPFALVASLGPPDKEPEQPLALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESARMKRGEKIRLPEFAAYLEVPVSDALEDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMYGSPEDGSIDEADLSCILKTALGISELTVTDLFQAIDQEERGRITFDDFCGFAEMYPDFAEDYLYPDQTHSDSCAQTPPAPTPNGFCIDFSPEHSDFGRKNSCKKVD | |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidylcholine acyltransferase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005811 | IEA:UniProtKB-KW | C | lipid particle |
| GO:0047184 | ISS:UniProtKB | F | 1-acylglycerophosphocholine O-acyltransferase activity |
| GO:0047159 | IEA:Ensembl | F | 1-alkenylglycerophosphocholine O-acyltransferase activity |
| GO:0047192 | IEA:UniProtKB-EC | F | 1-alkylglycerophosphocholine O-acetyltransferase activity |
| GO:0047191 | IEA:Ensembl | F | 1-alkylglycerophosphocholine O-acyltransferase activity |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:2001246 | IEA:Ensembl | P | negative regulation of phosphatidylcholine biosynthetic process |
| GO:0036151 | IEA:Ensembl | P | phosphatidylcholine acyl-chain remodeling |
| GO:0008654 | ISS:UniProtKB | P | phospholipid biosynthetic process |
| GO:0045732 | IEA:Ensembl | P | positive regulation of protein catabolic process |
| GO:0060041 | IEA:Ensembl | P | retina development in camera-type eye |
| GO:0043129 | IEA:Ensembl | P | surfactant homeostasis |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00565 | Ether lipid metabolism |
| rno00565 | Ether lipid metabolism |
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954464 | Acyl chain remodelling of PC |
| 5954465 | Acyl chain remodelling of PG |
| 5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5953473 | Glycerophospholipid biosynthesis |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953474 | Phospholipid metabolism |
| 5953472 | Synthesis of PA |
| 5953464 | Triglyceride Biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
lysophosphatidylcholine acyltransferase 1
Protein Entry
PCAT1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acetyl-CoA + 1-alkyl-sn-glycero-3- phosphocholine = CoA + 2-acetyl-1-alkyl-sn-glycero-3- phosphocholine. |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine |
| Domain | The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins |
| Enzyme Regulation | Not activated by inflammatory stimulation. Inhibited by Cu(2+) and Fe(2+). Activity is not affected by Co(2+), Mg(2+) or Mn(2+) (By similarity) |
| Function | Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology |
| Induction | By FGF7 |
| Pathway | Lipid metabolism; phospholipid metabolism. |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family |
| Similarity | Contains 2 EF-hand domains. {ECO:0000255|PROSITE- ProRule:PRU00448}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein . Golgi apparatus membrane ; Single-pass type II membrane protein {ECO:0000250}. Lipid droplet . Note=May adopt a monotopic topology when embedded in the lipid monolayer of the lipid droplet, with both termini exposed to the cytoplasm |
| Tissue Specificity | Enriched in alveolar type II cells of lung. Also highly expressed in stomach. {ECO:0000269|PubMed:16704971, ECO:0000269|PubMed:16864775}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013441 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 213688411 | RefSeq | NP_001094205 | 534 | lysophosphatidylcholine acyltransferase 1 |
Identical Sequences to LMP013441 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:213688411 | GenBank | EDL87651.1 | 534 | acyltransferase like 2 (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:213688411 | SwissProt | Q1HAQ0.2 | 534 | RecName: Full=Lysophosphatidylcholine acyltransferase 1; Short=LPC acyltransferase 1; Short=LPCAT-1; Short=LysoPC acyltransferase 1; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-alkylglycerophosphocholine O-acetyltransferase; AltName: Full=Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Short=Acetyl-CoA:lyso-PAF acetyltransferase; Short=Lyso-PAF acetyltransferase; Short=LysoPAFAT; AltName: Full=Acyltransferase-like 2 [Rattus norvegicus] |
Related Sequences to LMP013441 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:213688411 | DBBJ | BAE33166.1 | 534 | unnamed protein product [Mus musculus] |
| GI:213688411 | DBBJ | BAE41980.1 | 534 | unnamed protein product [Mus musculus] |
| GI:213688411 | GenBank | EDL87651.1 | 534 | acyltransferase like 2 (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:213688411 | SwissProt | Q1HAQ0.2 | 534 | RecName: Full=Lysophosphatidylcholine acyltransferase 1; Short=LPC acyltransferase 1; Short=LPCAT-1; Short=LysoPC acyltransferase 1; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-alkylglycerophosphocholine O-acetyltransferase; AltName: Full=Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Short=Acetyl-CoA:lyso-PAF acetyltransferase; Short=Lyso-PAF acetyltransferase; Short=LysoPAFAT; AltName: Full=Acyltransferase-like 2 [Rattus norvegicus] |