Gene/Proteome Database (LMPD)

LMPD ID
LMP013441
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
lysophosphatidylcholine acyltransferase 1
Gene Symbol
Synonyms
Aytl2; RGD1311599;
Alternate Names
lysophosphatidylcholine acyltransferase 1; LPCAT-1; lysoPAFAT; LPC acyltransferase 1; acyltransferase-like 2; lysoPC acyltransferase 1; lyso-PAF acetyltransferase; acetyl-CoA:lyso-PAF acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acetyl-CoA:lyso-platelet-activating factor acetyltransferase;
Chromosome
1
Map Location
1p11
EC Number
2.3.1.23

Proteins

lysophosphatidylcholine acyltransferase 1
Refseq ID NP_001094205
Protein GI 213688411
UniProt ID Q1HAQ0
mRNA ID NM_001100735
Length 534
MRLRGRGPRAAPSSSSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLFAAFMMLLAWPFALVASLGPPDKEPEQPLALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESARMKRGEKIRLPEFAAYLEVPVSDALEDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMYGSPEDGSIDEADLSCILKTALGISELTVTDLFQAIDQEERGRITFDDFCGFAEMYPDFAEDYLYPDQTHSDSCAQTPPAPTPNGFCIDFSPEHSDFGRKNSCKKVD

Gene Information

Entrez Gene ID
Gene Name
lysophosphatidylcholine acyltransferase 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005811 IEA:UniProtKB-KW C lipid particle
GO:0047184 ISS:UniProtKB F 1-acylglycerophosphocholine O-acyltransferase activity
GO:0047159 IEA:Ensembl F 1-alkenylglycerophosphocholine O-acyltransferase activity
GO:0047192 IEA:UniProtKB-EC F 1-alkylglycerophosphocholine O-acetyltransferase activity
GO:0047191 IEA:Ensembl F 1-alkylglycerophosphocholine O-acyltransferase activity
GO:0005509 IEA:InterPro F calcium ion binding
GO:2001246 IEA:Ensembl P negative regulation of phosphatidylcholine biosynthetic process
GO:0036151 IEA:Ensembl P phosphatidylcholine acyl-chain remodeling
GO:0008654 ISS:UniProtKB P phospholipid biosynthetic process
GO:0045732 IEA:Ensembl P positive regulation of protein catabolic process
GO:0060041 IEA:Ensembl P retina development in camera-type eye
GO:0043129 IEA:Ensembl P surfactant homeostasis

KEGG Pathway Links

KEGG Pathway ID Description
ko00565 Ether lipid metabolism
rno00565 Ether lipid metabolism
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5954464 Acyl chain remodelling of PC
5954465 Acyl chain remodelling of PG
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953474 Phospholipid metabolism
5953472 Synthesis of PA
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR018247 EF-Hand 1, calcium-binding site
IPR002048 EF-hand domain
IPR011992 EF-hand domain pair
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
lysophosphatidylcholine acyltransferase 1
Protein Entry
PCAT1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Acetyl-CoA + 1-alkyl-sn-glycero-3- phosphocholine = CoA + 2-acetyl-1-alkyl-sn-glycero-3- phosphocholine.
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine
Domain The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins
Enzyme Regulation Not activated by inflammatory stimulation. Inhibited by Cu(2+) and Fe(2+). Activity is not affected by Co(2+), Mg(2+) or Mn(2+) (By similarity)
Function Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology
Induction By FGF7
Pathway Lipid metabolism; phospholipid metabolism.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family
Similarity Contains 2 EF-hand domains. {ECO:0000255|PROSITE- ProRule:PRU00448}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein . Golgi apparatus membrane ; Single-pass type II membrane protein {ECO:0000250}. Lipid droplet . Note=May adopt a monotopic topology when embedded in the lipid monolayer of the lipid droplet, with both termini exposed to the cytoplasm
Tissue Specificity Enriched in alveolar type II cells of lung. Also highly expressed in stomach. {ECO:0000269|PubMed:16704971, ECO:0000269|PubMed:16864775}.

Identical and Related Proteins

Unique RefSeq proteins for LMP013441 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
213688411 RefSeq NP_001094205 534 lysophosphatidylcholine acyltransferase 1

Identical Sequences to LMP013441 proteins

Reference Database Accession Length Protein Name
GI:213688411 GenBank EDL87651.1 534 acyltransferase like 2 (predicted), isoform CRA_a [Rattus norvegicus]
GI:213688411 SwissProt Q1HAQ0.2 534 RecName: Full=Lysophosphatidylcholine acyltransferase 1; Short=LPC acyltransferase 1; Short=LPCAT-1; Short=LysoPC acyltransferase 1; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-alkylglycerophosphocholine O-acetyltransferase; AltName: Full=Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Short=Acetyl-CoA:lyso-PAF acetyltransferase; Short=Lyso-PAF acetyltransferase; Short=LysoPAFAT; AltName: Full=Acyltransferase-like 2 [Rattus norvegicus]

Related Sequences to LMP013441 proteins

Reference Database Accession Length Protein Name
GI:213688411 DBBJ BAE33166.1 534 unnamed protein product [Mus musculus]
GI:213688411 DBBJ BAE41980.1 534 unnamed protein product [Mus musculus]
GI:213688411 GenBank EDL87651.1 534 acyltransferase like 2 (predicted), isoform CRA_a [Rattus norvegicus]
GI:213688411 SwissProt Q1HAQ0.2 534 RecName: Full=Lysophosphatidylcholine acyltransferase 1; Short=LPC acyltransferase 1; Short=LPCAT-1; Short=LysoPC acyltransferase 1; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-alkylglycerophosphocholine O-acetyltransferase; AltName: Full=Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Short=Acetyl-CoA:lyso-PAF acetyltransferase; Short=Lyso-PAF acetyltransferase; Short=LysoPAFAT; AltName: Full=Acyltransferase-like 2 [Rattus norvegicus]