Gene/Proteome Database (LMPD)
Proteins
| ORM1-like protein 3 | |
|---|---|
| Refseq ID | NP_001041362 |
| Protein GI | 114145802 |
| UniProt ID | Q6QI25 |
| mRNA ID | NM_001047897 |
| Length | 180 |
| MGSPAPGLENSRFGAGYARAAVKRGGRMNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMSVLIPKLPQLHGVRIFGINKY | |
Gene Information
Entrez Gene ID
Gene Name
ORMDL sphingolipid biosynthesis regulator 3
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0035339 | ISS:UniProtKB | C | SPOTS complex |
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0006672 | ISS:UniProtKB | P | ceramide metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007203 | ORMDL family |
UniProt Annotations
Entry Information
Gene Name
ORMDL sphingolipid biosynthesis regulator 3
Protein Entry
ORML3_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Function | Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling (By similarity) |
| Sequence Caution | Sequence=AAS66274.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the ORM family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . |
| Subunit | Interacts with SPTLC1 |
Identical and Related Proteins
Unique RefSeq proteins for LMP013419 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 114145802 | RefSeq | NP_001041362 | 180 | ORM1-like protein 3 |
Identical Sequences to LMP013419 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:114145802 | GenBank | AAS66274.1 | 180 | LRRGT00183 [Rattus norvegicus] |
Related Sequences to LMP013419 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:114145802 | GenBank | AAS66274.1 | 180 | LRRGT00183 [Rattus norvegicus] |
| GI:114145802 | RefSeq | XP_004859532.1 | 197 | PREDICTED: ORM1-like protein 3 isoform X1 [Heterocephalus glaber] |
| GI:114145802 | RefSeq | XP_006534021.1 | 197 | PREDICTED: ORM1-like protein 3 isoform X1 [Mus musculus] |
| GI:114145802 | RefSeq | XP_006534022.1 | 172 | PREDICTED: ORM1-like protein 3 isoform X2 [Mus musculus] |