Gene/Proteome Database (LMPD)

LMPD ID
LMP013406
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Alternate Names
palmitoyltransferase ZDHHC15; DHHC-15; zinc finger, DHHC domain containing 15; zinc finger DHHC domain-containing protein 15; membrane-associated DHHC15 zinc finger protein;
Chromosome
X
Map Location
Xq31
EC Number
2.3.1.225

Proteins

palmitoyltransferase ZDHHC15
Refseq ID NP_001034190
Protein GI 84993239
UniProt ID Q2TGJ4
mRNA ID NM_001039101
Length 337
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGNGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEEPWEDNEDESQDYPEGLSSLAVESET

Gene Information

Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0045184 IEA:Ensembl P establishment of protein localization
GO:0018345 IEA:Ensembl P protein palmitoylation
GO:0016188 IEA:Ensembl P synaptic vesicle maturation

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
zinc finger, DHHC-type containing 15
Protein Entry
ZDH15_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity
Enzyme Regulation Inhibited by 2-bromopalmitate.
Function Palmitoyltransferase specific for GAP43 and DLG4/PSD95
Ptm Autopalmitoylated
Similarity Belongs to the DHHC palmitoyltransferase family
Similarity Contains 1 DHHC-type zinc finger
Subcellular Location Membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP013406 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
84993239 RefSeq NP_001034190 337 palmitoyltransferase ZDHHC15

Identical Sequences to LMP013406 proteins

Reference Database Accession Length Protein Name
GI:84993239 GenBank AAX73393.1 337 membrane-associated DHHC15 zinc finger protein [Rattus norvegicus]
GI:84993239 RefSeq XP_006257207.1 337 PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Rattus norvegicus]
GI:84993239 SwissProt Q2TGJ4.1 337 RecName: Full=Palmitoyltransferase ZDHHC15; AltName: Full=Zinc finger DHHC domain-containing protein 15; Short=DHHC-15 [Rattus norvegicus]

Related Sequences to LMP013406 proteins

Reference Database Accession Length Protein Name
GI:84993239 DBBJ BAE35757.1 337 unnamed protein product [Mus musculus]
GI:84993239 GenBank AAX73393.1 337 membrane-associated DHHC15 zinc finger protein [Rattus norvegicus]
GI:84993239 RefSeq XP_006257207.1 337 PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Rattus norvegicus]
GI:84993239 SwissProt Q2TGJ4.1 337 RecName: Full=Palmitoyltransferase ZDHHC15; AltName: Full=Zinc finger DHHC domain-containing protein 15; Short=DHHC-15 [Rattus norvegicus]