Gene/Proteome Database (LMPD)
LMPD ID
LMP013406
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Alternate Names
palmitoyltransferase ZDHHC15; DHHC-15; zinc finger, DHHC domain containing 15; zinc finger DHHC domain-containing protein 15; membrane-associated DHHC15 zinc finger protein;
Chromosome
X
Map Location
Xq31
EC Number
2.3.1.225
Proteins
| palmitoyltransferase ZDHHC15 | |
|---|---|
| Refseq ID | NP_001034190 |
| Protein GI | 84993239 |
| UniProt ID | Q2TGJ4 |
| mRNA ID | NM_001039101 |
| Length | 337 |
| MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGNGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEEPWEDNEDESQDYPEGLSSLAVESET | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0045184 | IEA:Ensembl | P | establishment of protein localization |
| GO:0018345 | IEA:Ensembl | P | protein palmitoylation |
| GO:0016188 | IEA:Ensembl | P | synaptic vesicle maturation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 15
Protein Entry
ZDH15_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity |
| Enzyme Regulation | Inhibited by 2-bromopalmitate. |
| Function | Palmitoyltransferase specific for GAP43 and DLG4/PSD95 |
| Ptm | Autopalmitoylated |
| Similarity | Belongs to the DHHC palmitoyltransferase family |
| Similarity | Contains 1 DHHC-type zinc finger |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013406 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 84993239 | RefSeq | NP_001034190 | 337 | palmitoyltransferase ZDHHC15 |
Identical Sequences to LMP013406 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:84993239 | GenBank | AAX73393.1 | 337 | membrane-associated DHHC15 zinc finger protein [Rattus norvegicus] |
| GI:84993239 | RefSeq | XP_006257207.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Rattus norvegicus] |
| GI:84993239 | SwissProt | Q2TGJ4.1 | 337 | RecName: Full=Palmitoyltransferase ZDHHC15; AltName: Full=Zinc finger DHHC domain-containing protein 15; Short=DHHC-15 [Rattus norvegicus] |
Related Sequences to LMP013406 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:84993239 | DBBJ | BAE35757.1 | 337 | unnamed protein product [Mus musculus] |
| GI:84993239 | GenBank | AAX73393.1 | 337 | membrane-associated DHHC15 zinc finger protein [Rattus norvegicus] |
| GI:84993239 | RefSeq | XP_006257207.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Rattus norvegicus] |
| GI:84993239 | SwissProt | Q2TGJ4.1 | 337 | RecName: Full=Palmitoyltransferase ZDHHC15; AltName: Full=Zinc finger DHHC domain-containing protein 15; Short=DHHC-15 [Rattus norvegicus] |