Gene/Proteome Database (LMPD)

LMPD ID
LMP013388
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
beta-carotene oxygenase 2
Gene Symbol
Synonyms
Bcdo2; Ab2-079;
Alternate Names
beta,beta-carotene 9',10'-oxygenase; carotenoid 9',10' monoxygenase II; carotenoid 9',10' monooxygenase II; beta-carotene 9', 10'-dioxygenase 2;
Chromosome
8
Map Location
8q23

Proteins

beta,beta-carotene 9',10'-oxygenase
Refseq ID NP_001121184
Protein GI 189181706
UniProt ID A3KN98
mRNA ID NM_001127712
Length 532
MLGPQQSLPCIAPLLTTVEETLSTVSARVRGHIPEWLNGYLLRVGPGKFEFGKDRYNHWFDGMALLHQFKMEKGTVTYKSKFLQSDTYKANSAGDRIVISEFGTLALPDPCKSIFERFMSRFEPPTMTDNTSVNFVQYKGDYYMSTETNFMNKVDIETLERTEKVDWSKFVAVNGATAHPHYDPDGTAYNMGNTYGPRGSCYNIIRVPPKKKEPGETIHGAQVVCSIASSEKMKPSYYHSFGMTKNYIVFVEQPLKMKLWKIITSKIRGKSFADGISWEPQYNTRFHVVDKHTGQPLPGVYYSKPFLTYHQINAFEDQGCIVIDLCCEDDGRSLDIYQLQNLRKAGEELDQVYKAKAKSFPRRFVLPLDISVGAPEGENLRPLPYSSASVVKQGDREIWCSPENLHQEDLEEEGGIEFPQINYGRFSGKKYSFFYGCGFRHLVGDSLIKVDVVNKTLRVWREEGCYPSEPVFVPVPGADEEDSGAILSVVITPNQGESNFLLVLDAKNFTELGRAEVPVRMPYGFHGTFVPI

Gene Information

Entrez Gene ID
Gene Name
beta-carotene oxygenase 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:Ensembl C mitochondrion
GO:0016702 IEA:Ensembl F oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0016121 IEA:Ensembl P carotene catabolic process
GO:0016116 IEA:Ensembl P carotenoid metabolic process
GO:0051881 IEA:Ensembl P regulation of mitochondrial membrane potential
GO:2000377 IEA:Ensembl P regulation of reactive oxygen species metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5953253 Disease
5953382 Diseases associated with visual transduction
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR004294 Carotenoid oxygenase

UniProt Annotations

Entry Information

Gene Name
beta-carotene oxygenase 2
Protein Entry
A3KN98_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013388 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
189181706 RefSeq NP_001121184 532 beta,beta-carotene 9',10'-oxygenase

Identical Sequences to LMP013388 proteins

Reference Database Accession Length Protein Name
GI:189181706 GenBank AAI33726.1 532 Bco2 protein [Rattus norvegicus]

Related Sequences to LMP013388 proteins

Reference Database Accession Length Protein Name
GI:189181706 GenBank AAI33726.1 532 Bco2 protein [Rattus norvegicus]
GI:189181706 GenBank EDL25739.1 532 beta-carotene 9', 10'-dioxygenase 2 [Mus musculus]
GI:189181706 RefSeq XP_006510107.1 532 PREDICTED: beta,beta-carotene 9',10'-oxygenase isoform X1 [Mus musculus]
GI:189181706 SwissProt Q99NF1.1 532 RecName: Full=Beta,beta-carotene 9',10'-oxygenase; AltName: Full=B-diox-II; AltName: Full=Beta-carotene dioxygenase 2 [Mus musculus]