Gene/Proteome Database (LMPD)

LMPD ID
LMP013365
Gene ID
313706
Species
Rattus norvegicus (Rat)
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Ubiad1
Synonyms
RGD1309588;
Alternate Names
ubiA prenyltransferase domain-containing protein 1;
Chromosome
5
Map Location
5q36
EC Number
2.5.1.-;

Proteins

ubiA prenyltransferase domain-containing protein 1
Refseq ID NP_001101463
Protein GI 157819075
UniProt ID D3ZG27
mRNA ID NM_001107993
Length 338
MAAVQAPGEKINIQAGETTQVGDTDQQRNDWPEEDRLPERSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSQGVLDPRLLLGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAAYLYYLSTLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLVILITFGPLAVMFAYAVQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTLSYILYNTLLFLPYLIFTILATHCSISLALPLLTSPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPRL

Gene Information

Entrez Gene ID
313706
Gene Name
UbiA prenyltransferase domain containing 1
Gene Symbol
Ubiad1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0030173 ISS:UniProtKB C integral component of Golgi membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0016209 ISS:UniProtKB F antioxidant activity
GO:0004659 ISS:UniProtKB F prenyltransferase activity
GO:0072358 ISS:UniProtKB P cardiovascular system development
GO:0001885 ISS:UniProtKB P endothelial cell development
GO:0009234 ISS:UniProtKB P menaquinone biosynthetic process
GO:0006744 ISS:UniProtKB P ubiquinone biosynthetic process
GO:0042371 ISS:UniProtKB P vitamin K biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR026046 UbiA prenyltransferase domain containing protein 1
IPR000537 UbiA prenyltransferase family

UniProt Annotations

Entry Information

Gene Name
UbiA prenyltransferase domain containing 1
Protein Entry
UBIA1_RAT
UniProt ID
D3ZG27
Species
Rat

Comments

Comment Type Description
Function Prenyltransferase that mediates the formation of menaquinone-4 (MK-4) and coenzyme Q10. MK-4 is a vitamin K2 isoform required for endothelial cell development. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4- naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Also plays a role in cardiovascular development independently of MK-4 biosynthesis, by acting as a coenzyme Q10 biosyntetic enzyme: coenzyme Q10, also named ubiquinone, plays a important antioxidant role in the cardiovascular system. Mediates biosynthesis of coenzyme Q10 in the Golgi membrane, leading to protect cardiovascular tissues from NOS3/eNOS-dependent oxidative stress (By similarity)
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Pathway Quinol/quinone metabolism; menaquinone biosynthesis.
Similarity Belongs to the UbiA prenyltransferase family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . Golgi apparatus membrane ; Multi-pass membrane protein {ECO:0000250}. Mitochondrion .
Subunit Interacts with HMGCR and SOAT1

Identical and Related Proteins

Unique RefSeq proteins for LMP013365 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157819075 RefSeq NP_001101463 338 ubiA prenyltransferase domain-containing protein 1

Identical Sequences to LMP013365 proteins

Reference Database Accession Length Protein Name
GI:157819075 GenBank EDL81120.1 338 UbiA prenyltransferase domain containing 1 (predicted), isoform CRA_b [Rattus norvegicus]
GI:157819075 GenBank AGC99288.1 338 Sequence 27 from patent US 8334369
GI:157819075 SwissProt D3ZG27.1 338 RecName: Full=UbiA prenyltransferase domain-containing protein 1 [Rattus norvegicus]

Related Sequences to LMP013365 proteins

Reference Database Accession Length Protein Name
GI:157819075 GenBank EDL81120.1 338 UbiA prenyltransferase domain containing 1 (predicted), isoform CRA_b [Rattus norvegicus]
GI:157819075 GenBank AGC99288.1 338 Sequence 27 from patent US 8334369
GI:157819075 RefSeq XP_003513224.1 338 PREDICTED: ubiA prenyltransferase domain-containing protein 1 [Cricetulus griseus]
GI:157819075 SwissProt D3ZG27.1 338 RecName: Full=UbiA prenyltransferase domain-containing protein 1 [Rattus norvegicus]