Gene/Proteome Database (LMPD)

LMPD ID
LMP013361
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
platelet-activating factor acetylhydrolase 2
Gene Symbol
Alternate Names
platelet-activating factor acetylhydrolase 2, cytoplasmic; SD-PLA2; serine-dependent phospholipase A2; platelet-activating factor acetylhydrolase 2 40kDa; platelet-activating factor acetylhydrolase 2, 40kDa;
Chromosome
5
Map Location
5q36
EC Number
3.1.1.47
Summary
human homolog catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor resulting in inactivation [RGD, Feb 2006]
Orthologs

Proteins

platelet-activating factor acetylhydrolase 2, cytoplasmic
Refseq ID NP_808793
Protein GI 29293821
UniProt ID P83006
mRNA ID NM_177932
Length 390
MGAGQSICFPPISGPHHIGCTDVMEGHSLEGSLFRLFYPCEASETCEQPLWIPRYEYCVGLADYLQYNKRWVGLLFNVGIGSCRLPVSWNGPFKTKESGYPLIILSHGLGGFRVSYSAFCMELASRGFVVAAIEHRDQSAAATYFCKQTSQESSPTESLEEEWIPFRRIKEGEKEFHVRNPQVHQRAKECVRVLQILQDASAGKPVINVFPGGLDLMTLKGSIDMSRVAVMGHSFGGATAILALTQEAQFRCAIALDAWMFPLEHDFYPKARGPVFFINVEKFQTVESVNLMKKICAQHEQSRIVTVLGAVHRSQTDFAFVTGNMIGKLFSSGTRGTLDPYEGQEVMVRAMLAFLQKHLDLKEDYDQWNSFIEGIGPSLIQGAPHYLSSL

Gene Information

Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0003847 IMP:RGD F 1-alkyl-2-acetylglycerophosphocholine esterase activity
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0043066 IMP:RGD P negative regulation of apoptotic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00565 Ether lipid metabolism
rno00565 Ether lipid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR005065 Platelet-activating factor acetylhydrolase
IPR016715 Platelet-activating factor acetylhydrolase, eucaryote

UniProt Annotations

Entry Information

Gene Name
platelet-activating factor acetylhydrolase 2
Protein Entry
PAFA2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate.
Function Catalyzes transacetylation of the acetyl group from platelet-activating factor (PAF) to lysoplasmalogen and to sphingosine, producing plasmalogen analogs of PAF and N- acetylsphingosine (C2-ceramide) respectively. Also acts as a PAF- acetylhydrolase in the absence of lipid acceptor molecules
Similarity Belongs to the serine esterase family
Subcellular Location Cytoplasm .
Subunit Monomer

Identical and Related Proteins

Unique RefSeq proteins for LMP013361 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
29293821 RefSeq NP_808793 390 platelet-activating factor acetylhydrolase 2, cytoplasmic

Identical Sequences to LMP013361 proteins

Reference Database Accession Length Protein Name
GI:29293821 GenBank EDL80720.1 390 platelet-activating factor acetylhydrolase 2, isoform CRA_a [Rattus norvegicus]
GI:29293821 GenBank AEU43401.1 390 Sequence 150 from patent US 8052970
GI:29293821 RefSeq XP_006239189.1 390 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic isoform X1 [Rattus norvegicus]
GI:29293821 SwissProt P83006.2 390 RecName: Full=Platelet-activating factor acetylhydrolase 2, cytoplasmic; AltName: Full=Serine-dependent phospholipase A2; Short=SD-PLA2 [Rattus norvegicus]

Related Sequences to LMP013361 proteins

Reference Database Accession Length Protein Name
GI:29293821 GenBank EDL80720.1 390 platelet-activating factor acetylhydrolase 2, isoform CRA_a [Rattus norvegicus]
GI:29293821 GenBank AEU43401.1 390 Sequence 150 from patent US 8052970
GI:29293821 RefSeq XP_006239189.1 390 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic isoform X1 [Rattus norvegicus]
GI:29293821 SwissProt P83006.2 390 RecName: Full=Platelet-activating factor acetylhydrolase 2, cytoplasmic; AltName: Full=Serine-dependent phospholipase A2; Short=SD-PLA2 [Rattus norvegicus]