Gene/Proteome Database (LMPD)
LMPD ID
LMP013361
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
platelet-activating factor acetylhydrolase 2
Gene Symbol
Alternate Names
platelet-activating factor acetylhydrolase 2, cytoplasmic; SD-PLA2; serine-dependent phospholipase A2; platelet-activating factor acetylhydrolase 2 40kDa; platelet-activating factor acetylhydrolase 2, 40kDa;
Chromosome
5
Map Location
5q36
EC Number
3.1.1.47
Summary
human homolog catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor resulting in inactivation [RGD, Feb 2006]
Orthologs
Proteins
| platelet-activating factor acetylhydrolase 2, cytoplasmic | |
|---|---|
| Refseq ID | NP_808793 |
| Protein GI | 29293821 |
| UniProt ID | P83006 |
| mRNA ID | NM_177932 |
| Length | 390 |
| MGAGQSICFPPISGPHHIGCTDVMEGHSLEGSLFRLFYPCEASETCEQPLWIPRYEYCVGLADYLQYNKRWVGLLFNVGIGSCRLPVSWNGPFKTKESGYPLIILSHGLGGFRVSYSAFCMELASRGFVVAAIEHRDQSAAATYFCKQTSQESSPTESLEEEWIPFRRIKEGEKEFHVRNPQVHQRAKECVRVLQILQDASAGKPVINVFPGGLDLMTLKGSIDMSRVAVMGHSFGGATAILALTQEAQFRCAIALDAWMFPLEHDFYPKARGPVFFINVEKFQTVESVNLMKKICAQHEQSRIVTVLGAVHRSQTDFAFVTGNMIGKLFSSGTRGTLDPYEGQEVMVRAMLAFLQKHLDLKEDYDQWNSFIEGIGPSLIQGAPHYLSSL | |
Gene Information
Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0003847 | IMP:RGD | F | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0043066 | IMP:RGD | P | negative regulation of apoptotic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
platelet-activating factor acetylhydrolase 2
Protein Entry
PAFA2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate. |
| Function | Catalyzes transacetylation of the acetyl group from platelet-activating factor (PAF) to lysoplasmalogen and to sphingosine, producing plasmalogen analogs of PAF and N- acetylsphingosine (C2-ceramide) respectively. Also acts as a PAF- acetylhydrolase in the absence of lipid acceptor molecules |
| Similarity | Belongs to the serine esterase family |
| Subcellular Location | Cytoplasm . |
| Subunit | Monomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP013361 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 29293821 | RefSeq | NP_808793 | 390 | platelet-activating factor acetylhydrolase 2, cytoplasmic |
Identical Sequences to LMP013361 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:29293821 | GenBank | EDL80720.1 | 390 | platelet-activating factor acetylhydrolase 2, isoform CRA_a [Rattus norvegicus] |
| GI:29293821 | GenBank | AEU43401.1 | 390 | Sequence 150 from patent US 8052970 |
| GI:29293821 | RefSeq | XP_006239189.1 | 390 | PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic isoform X1 [Rattus norvegicus] |
| GI:29293821 | SwissProt | P83006.2 | 390 | RecName: Full=Platelet-activating factor acetylhydrolase 2, cytoplasmic; AltName: Full=Serine-dependent phospholipase A2; Short=SD-PLA2 [Rattus norvegicus] |
Related Sequences to LMP013361 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:29293821 | GenBank | EDL80720.1 | 390 | platelet-activating factor acetylhydrolase 2, isoform CRA_a [Rattus norvegicus] |
| GI:29293821 | GenBank | AEU43401.1 | 390 | Sequence 150 from patent US 8052970 |
| GI:29293821 | RefSeq | XP_006239189.1 | 390 | PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic isoform X1 [Rattus norvegicus] |
| GI:29293821 | SwissProt | P83006.2 | 390 | RecName: Full=Platelet-activating factor acetylhydrolase 2, cytoplasmic; AltName: Full=Serine-dependent phospholipase A2; Short=SD-PLA2 [Rattus norvegicus] |